Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3217

Name

HOXB7

Synonym

HHO.C1|HOX2|HOX2C|Hox-2.3;homeobox B7;HOXB7;homeobox B7

Definition

homeo box 2C|homeo box B7|homeo box c1 protein|homeobox protein HHO.C1|homeobox protein Hox-2C|homeobox protein Hox-B7

Position

17q21.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

3217

Links to all GeneRIF Items

3217

Links to iHOP

3217

Sequence Information

Nucleotide Sequence

>3217 : length: 654
atgagttcattgtattatgcgaatactttattttctaaatatccagcctcaagttcggtt
ttcgctaccggagccttcccagaacaaacttcttgtgcgtttgcttccaacccccagcgc
ccgggctatggagcgggttcgggcgcttccttcgccgcctcgatgcagggcttgtacccc
ggcggggggggcatggcgggccagagcgcggccggcgtctacgcggccggctatgggctc
gagccgagttccttcaacatgcactgcgcgccctttgagcagaacctctccggggtgtgt
cccggcgactccgccaaggcggcgggcgccaaggagcagagggactcggacttggcggcc
gagagtaacttccggatctacccctggatgcgaagctcaggaactgaccgcaaacgaggc
cgccagacctacacccgctaccagaccctggagctggagaaagaatttcactacaatcgc
tacctgacgcggcggcggcgcatcgagatcgcgcacacgctctgcctcacggaaagacag
atcaagatttggtttcagaaccggcgcatgaagtggaaaaaggagaacaagaccgcgggc
ccggggaccaccggccaagacagggctgaagcagaggaggaagaggaagagtga

Protein Sequence

>3217 : length: 217
MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYP
GGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
ESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQ
IKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE



')