Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3206

Name

HOXA10

Synonym

HOX1|HOX1.8|HOX1H|PL;homeobox A10;HOXA10;homeobox A10

Definition

homeo box A10|homeobox protein 1H|homeobox protein HOXA10|homeobox protein Hox-1.8|homeobox protein Hox-1H|homeobox protein Hox-A10

Position

7p15.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by HDAC Class III;PID Curated;200020

Disease

Endometrial cancer;FunDO

Disease

Leukemia;FunDO

Disease

Embryoma;FunDO

Disease

Polycystic ovary syndrome;FunDO

Disease

Endometriosis;FunDO

External Links

Links to Entrez Gene

3206

Links to all GeneRIF Items

3206

Links to iHOP

3206

Sequence Information

Nucleotide Sequence

>3206 : length: 1233
atgtcagccagaaagggctatctgctcccttcgccaaattatcccacaacaatgtcatgc
tcggagagccccgccgcgaactcttttttggtcgactcgctcatcagctcgggcagaggc
gaggcaggcggcggtggtggtggcgcggggggcggcggcggtggcggttactacgcccac
ggcggggtctacctgccgcccgccgccgacctgccctacgggctgcagagctgcgggctc
ttccccacgctgggcggcaagcgcaatgaggcagcgtcgccgggcagcggtggcggtggc
gggggtctaggtcccggggcgcacggctacgggccctcgcccatagacctgtggctagac
gcgccccggtcttgccggatggagccgcctgacgggccgccgccgccgccccagcagcag
ccgccgcccccgccgcaaccaccccagccagcgccgcaggccacctcgtgctctttcgcg
cagaacatcaaagaagagagctcctactgcctctacgactcggcggacaaatgccccaaa
gtctcggccaccgccgccgaactggctcccttcccgcggggcccgccgcccgacggctgc
gccctgggcacctccagcggggtgccagtgcctggctacttccgcctttctcaggcctac
ggcaccgccaagggctatggcagcggcggcggcggcgcgcagcaactcggggctggcccg
ttccccgcgcagcccccggggcgcggtttcgatctcccgcccgcgctagcctccggctcg
gccgatgcggcccggaaggagcgagccctcgattcgccgccgccccccacgctggcttgc
ggcagcggcgggggctcgcagggcgacgaggaggcgcacgcgtcgtcctcggccgcggag
gagctctccccggccccttccgagagcagcaaagcctcgccggagaaggattccctgggc
aattccaaaggtgaaaacgcagccaactggctcacggcaaagagtggtcggaagaagcgc
tgcccctacacgaagcaccagacactggagctggagaaggagtttctgttcaatatgtac
cttactcgagagcggcgcctagagattagccgcagcgtccacctcacggacagacaagtg
aaaatctggtttcagaaccgcaggatgaaactgaagaaaatgaatcgagaaaaccggatc
cgggagctcacagccaactttaatttttcctga

Protein Sequence

>3206 : length: 410
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAH
GGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLD
APRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPK
VSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGP
FPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAE
ELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMY
LTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS



')