Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3172

Name

HNF4A

Synonym

HNF4|HNF4a7|HNF4a8|HNF4a9|HNF4alpha|MODY|MODY1|NR2A1|NR2A21|TCF|TCF14;hepatocyte nuclear factor 4, alpha;HNF4A;hepatocyte nuclear factor 4, alpha

Definition

HNF-4-alpha|HNF4alpha10/11/12|TCF-14|hepatic nuclear factor 4 alpha|hepatocyte nuclear factor 4-alpha|nuclear receptor subfamily 2 group A member 1|transcription factor 14|transcription factor HNF-4|transcription factor-14

Position

20q13.12

Gene Type

protein-coding

Pathways and Diseases

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Maturity onset diabetes of the young;KEGG PATHWAY;hsa04950

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

FOXA2 and FOXA3 transcription factor networks;PID Curated;200073

Pathway

Regulation of beta-cell development;Reactome;REACT:13698

Pathway

Gene Expression;Reactome;REACT:71

Disease

Maturity onset diabetes of the young (MODY);KEGG DISEASE;H00410

Disease

METABOLIC;GAD

Disease

diabetes, type 2;GAD

Disease

Metabolic diseases;KEGG DISEASE

Disease

Diabetes mellitus;FunDO

Disease

birth weight hypoglycemia;GAD

Disease

IMMUNE;GAD

Disease

cholesterol metabolic syndrome triglycerides;GAD

Disease

Hyperinsulinism;FunDO

Disease

HDL cholesterol;NHGRI

Disease

Ulcerative colitis;NHGRI

Disease

Pancreas disease;FunDO

Disease

plasma HDL cholesterol (HDL-C) levels;GAD

Disease

MODY, type I;OMIM

Disease

HDL cholesterol;GAD

Disease

Diabetes;KEGG DISEASE

Disease

ulcerative colitis;GAD

Disease

Diabetes mellitus, noninsulin-dependent;OMIM

Disease

Metabolism disease;FunDO

External Links

Links to Entrez Gene

3172

Links to all GeneRIF Items

3172

Links to iHOP

3172

Sequence Information

Nucleotide Sequence

>3172 : length: 1425
atgcgactctccaaaaccctcgtcgacatggacatggccgactacagtgctgcactggac
ccagcctacaccaccctggaatttgagaatgtgcaggtgttgacgatgggcaatgacacg
tccccatcagaaggcaccaacctcaacgcgcccaacagcctgggtgtcagcgccctgtgt
gccatctgcggggaccgggccacgggcaaacactacggtgcctcgagctgtgacggctgc
aagggcttcttccggaggagcgtgcggaagaaccacatgtactcctgcagatttagccgg
cagtgcgtggtggacaaagacaagaggaaccagtgccgctactgcaggctcaagaaatgc
ttccgggctggcatgaagaaggaagccgtccagaatgagcgggaccggatcagcactcga
aggtcaagctatgaggacagcagcctgccctccatcaatgcgctcctgcaggcggaggtc
ctgtcccgacagatcacctcccccgtctccgggatcaacggcgacattcgggcgaagaag
attgccagcatcgcagatgtgtgtgagtccatgaaggagcagctgctggttctcgttgag
tgggccaagtacatcccagctttctgcgagctccccctggacgaccaggtggccctgctc
agagcccatgctggcgagcacctgctgctcggagccaccaagagatccatggtgttcaag
gacgtgctgctcctaggcaatgactacattgtccctcggcactgcccggagctggcggag
atgagccgggtgtccatacgcatccttgacgagctggtgctgcccttccaggagctgcag
atcgatgacaatgagtatgcctacctcaaagccatcatcttctttgacccagatgccaag
gggctgagcgatccagggaagatcaagcggctgcgttcccaggtgcaggtgagcttggag
gactacatcaacgaccgccagtatgactcgcgtggccgctttggagagctgctgctgctg
ctgcccaccttgcagagcatcacctggcagatgatcgagcagatccagttcatcaagctc
ttcggcatggccaagattgacaacctgttgcaggagatgctgctgggagggtcccccagc
gatgcaccccatgcccaccaccccctgcaccctcacctgatgcaggaacatatgggaacc
aacgtcatcgttgccaacacaatgcccactcacctcagcaacggacagatgtgtgagtgg
ccccgacccaggggacaggcagccacccctgagaccccacagccctcaccgccaggtggc
tcagggtctgagccctataagctcctgccgggagccgtcgccacaatcgtcaagcccctc
tctgccatcccccagccgaccatcaccaagcaggaagttatctag

Protein Sequence

>3172 : length: 474
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI



')