Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3169

Name

FOXA1

Synonym

HNF3A|TCF3A;forkhead box A1;FOXA1;forkhead box A1

Definition

HNF-3-alpha|HNF-3A|TCF-3A|forkhead box protein A1|hepatocyte nuclear factor 3, alpha|hepatocyte nuclear factor 3-alpha|transcription factor 3A

Position

14q12-q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

FOXA2 and FOXA3 transcription factor networks;PID Curated;200073

Pathway

FOXA transcription factor networks;PID Curated;200163

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

FOXA1 transcription factor network;PID Curated;200194

External Links

Links to Entrez Gene

3169

Links to all GeneRIF Items

3169

Links to iHOP

3169

Sequence Information

Nucleotide Sequence

>3169 : length: 1419
atgttaggaactgtgaagatggaagggcatgaaaccagcgactggaacagctactacgca
gacacgcaggaggcctactcctccgtcccggtcagcaacatgaactcaggcctgggctcc
atgaactccatgaacacctacatgaccatgaacaccatgactacgagcggcaacatgacc
ccggcgtccttcaacatgtcctatgccaacccgggcctaggggccggcctgagtcccggc
gcagtagccggcatgccggggggctcggcgggcgccatgaacagcatgactgcggccggc
gtgacggccatgggtacggcgctgagcccgagcggcatgggcgccatgggtgcgcagcag
gcggcctccatgaatggcctgggcccctacgcggccgccatgaacccgtgcatgagcccc
atggcgtacgcgccgtccaacctgggccgcagccgcgcgggcggcggcggcgacgccaag
acgttcaagcgcagctacccgcacgccaagccgccctactcgtacatctcgctcatcacc
atggccatccagcaggcgcccagcaagatgctcacgctgagcgagatctaccagtggatc
atggacctcttcccctattaccggcagaaccagcagcgctggcagaactccatccgccac
tcgctgtccttcaatgactgcttcgtcaaggtggcacgctccccggacaagccgggcaag
ggctcctactggacgctgcacccggactccggcaacatgttcgagaacggctgctacttg
cgccgccagaagcgcttcaagtgcgagaagcagccgggggccggcggcgggggcgggagc
ggaagcgggggcagcggcgccaagggcggccctgagagccgcaaggacccctctggcgcc
tctaaccccagcgccgactcgcccctccatcggggtgtgcacgggaagaccggccagcta
gagggcgcgccggcccccgggcccgccgccagcccccagactctggaccacagtggggcg
acggcgacagggggcgcctcggagttgaagactccagcctcctcaactgcgccccccata
agctccgggcccggggcgctggcctctgtgcccgcctctcacccggcacacggcttggca
ccccacgagtcccagctgcacctgaaaggggacccccactactccttcaaccacccgttc
tccatcaacaacctcatgtcctcctcggagcagcagcataagctggacttcaaggcatac
gaacaggcactgcaatactcgccttacggctctacgttgcccgccagcctgcctctaggc
agcgcctcggtgaccaccaggagccccatcgagccctcagccctggagccggcgtactac
caaggtgtgtattccagacccgtcctaaacacttcctag

Protein Sequence

>3169 : length: 472
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT
PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ
AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLIT
MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK
GSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA
SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI
SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS



')