Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3162

Name

HMOX1

Synonym

HO-1|HSP32|bK286B10;heme oxygenase (decycling) 1;HMOX1;heme oxygenase (decycling) 1

Definition

heat shock protein, 32-kD|heme oxygenase 1

Position

22q12|22q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Porphyrin and chlorophyll metabolism;KEGG PATHWAY;hsa00860

Pathway

heme degradation;BioCyc;PWY-5874

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Metabolism of porphyrins;Reactome;REACT:9431

Pathway

il-10 anti-inflammatory signaling pathway;PID BioCarta;100134

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Disease

Malaria, Cerebral;GAD

Disease

idiopathic recurrent miscarriage.;GAD

Disease

pregnancy loss, recurrent;GAD

Disease

Heme oxygenase-1 deficiency;OMIM

Disease

lymphovascular tumor invasion stomach cancer;GAD

Disease

Stomach Neoplasms;GAD

Disease

abdominal aortic aneurysm;GAD

Disease

oral cancer;GAD

Disease

inflammatory response;GAD

Disease

hypertension;GAD

Disease

lung cancer;GAD

Disease

atherosclerosis, coronary;GAD

Disease

IMMUNE;GAD

Disease

kidney transplant;GAD

Disease

METABOLIC;GAD

Disease

restenosis;GAD

Disease

INFECTION;GAD

Disease

emphysema;GAD

Disease

diabetes, type 2;GAD

Disease

heart disease, ischemic;GAD

Disease

Coronary Artery Disease;GAD

Disease

arteriovenous fistulas;GAD

Disease

CARDIOVASCULAR;GAD

Disease

CANCER;GAD

Disease

melanoma;GAD

Disease

Pulmonary disease, chronic obstructive, susceptibility to;OMIM

Disease

REPRODUCTION;GAD

Disease

restenosis after percutaneous transluminal angioplasty;GAD

Disease

pneumonia;GAD

Disease

lung function;GAD

Disease

aneurysm, abdominal aortic;GAD

Disease

myocardial infarct;GAD

Disease

RENAL;GAD

External Links

Links to Entrez Gene

3162

Links to all GeneRIF Items

3162

Links to iHOP

3162

Sequence Information

Nucleotide Sequence

>3162 : length: 867
atggagcgtccgcaacccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacacccaggcagagaatgctgagttcatgaggaactttcagaagggc
caggtgacccgagacggcttcaagctggtgatggcctccctgtaccacatctatgtggcc
ctggaggaggagattgagcgcaacaaggagagcccagtcttcgcccctgtctacttccca
gaagagctgcaccgcaaggctgccctggagcaggacctggccttctggtacgggccccgc
tggcaggaggtcatcccctacacaccagccatgcagcgctatgtgaagcggctccacgag
gtggggcgcacagagcccgagctgctggtggcccacgcctacacccgctacctgggtgac
ctgtctgggggccaggtgctcaaaaagattgcccagaaagccctggacctgcccagctct
ggcgagggcctggccttcttcaccttccccaacattgccagtgccaccaagttcaagcag
ctctaccgctcccgcatgaactccctggagatgactcccgcagtcaggcagagggtgata
gaagaggccaagactgcgttcctgctcaacatccagctctttgaggagttgcaggagctg
ctgacccatgacaccaaggaccagagcccctcacgggcaccagggcttcgccagcgggcc
agcaacaaagtgcaagattctgcccccgtggagactcccagagggaagcccccactcaac
acccgctcccaggctccgcttctccgatgggtccttacactcagctttctggtggcgaca
gttgctgtagggctttatgccatgtga

Protein Sequence

>3162 : length: 288
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM



')