Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3149

Name

HMGB3

Synonym

HMG-2a|HMG-4|HMG2A|HMG4;high mobility group box 3;HMGB3;high mobility group box 3

Definition

high mobility group protein 2a|high mobility group protein 4|high mobility group protein B3|high-mobility group (nonhistone chromosomal) protein 4|high-mobility group box 3|non-histone chromosomal protein

Position

Xq28

Gene Type

protein-coding

External Links

Links to Entrez Gene

3149

Links to all GeneRIF Items

3149

Links to iHOP

3149

Sequence Information

Nucleotide Sequence

>3149 : length: 603
atggctaaaggtgaccccaagaaaccaaagggcaagatgtccgcttatgccttctttgtg
cagacatgcagagaagaacataagaagaaaaacccagaggtccctgtcaattttgcggaa
ttttccaagaagtgctctgagaggtggaagacgatgtccgggaaagagaaatctaaattt
gatgaaatggcaaaggcagataaagtgcgctatgatcgggaaatgaaggattatggacca
gctaagggaggcaagaagaagaaggatcctaatgctcccaaaaggccaccgtctggattc
ttcctgttctgttcagaattccgccccaagatcaaatccacaaaccccggcatctctatt
ggagacgtggcaaaaaagctgggtgagatgtggaataatttaaatgacagtgaaaagcag
ccttacatcactaaggcggcaaagctgaaggagaagtatgagaaggatgttgctgactat
aagtcgaaaggaaagtttgatggtgcaaagggtcctgctaaagttgcccggaaaaaggtg
gaagaggaagatgaagaagaggaggaggaagaagaggaggaggaggaggaggaggatgaa
taa

Protein Sequence

>3149 : length: 200
MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKF
DEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISI
GDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKV
EEEDEEEEEEEEEEEEEEDE



')