Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3146

Name

HMGB1

Synonym

HMG1|HMG3|SBP-1;high mobility group box 1;HMGB1;high mobility group box 1

Definition

Amphoterin|HMG-1|Sulfoglucuronyl carbohydrate binding protein|high mobility group protein 1|high mobility group protein B1|high-mobility group (nonhistone chromosomal) protein 1|high-mobility group box 1

Position

13q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

p53 pathway;PANTHER;P00059

Pathway

Base excision repair;KEGG PATHWAY;hsa03410

Pathway

Endogenous TLR signaling;PID Curated;200177

Pathway

apoptotic dna-fragmentation and tissue homeostasis;PID BioCarta;100187

Pathway

the information processing pathway at the ifn beta enhancer;PID BioCarta;100079

Pathway

amb2 Integrin signaling;PID Curated;200108

External Links

Links to Entrez Gene

3146

Links to all GeneRIF Items

3146

Links to iHOP

3146

Sequence Information

Nucleotide Sequence

>3146 : length: 648
atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattttttgtg
caaacttgtcgggaggagcataagaagaagcacccagatgcttcagtcaacttctcagag
ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt
gaagatatggcaaaagcggacaaggcccgttatgaaagagaaatgaaaacctatatccct
cccaaaggggagacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg
gccttcttcctcttctgctctgagtatcgcccaaaaatcaaaggagaacatcctggcctg
tccattggtgatgttgcgaagaaactgggagagatgtggaataacactgctgcagatgac
aagcagccttatgaaaagaaggctgcgaagctgaaggaaaaatacgaaaaggatattgct
gcatatcgagctaaaggaaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa
agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggag
gaagatgaagaagatgaagatgaagaagaagatgatgatgatgaataa

Protein Sequence

>3146 : length: 215
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE



')