Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3082

Name

HGF

Synonym

DFNB39|F-TCF|HGFB|HPTA|SF;hepatocyte growth factor (hepapoietin A; scatter factor);HGF;hepatocyte growth factor (hepapoietin A; scatter factor)

Definition

fibroblast-derived tumor cytotoxic factor|hepatocyte growth factor|hepatopoeitin-A|hepatopoietin-A|lung fibroblast-derived mitogen

Position

7q21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Arf6 signaling events;PID Curated;200060

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

FGF signaling pathway;PID Curated;200189

Disease

blood pressure, arterial;GAD

Disease

hypertension;GAD

Disease

Deafness, autosomal recessive 39;OMIM

Disease

VISION;GAD

Disease

CARDIOVASCULAR;GAD

Disease

carotid atherosclerosis;GAD

Disease

Myopia;GAD

External Links

Links to Entrez Gene

3082

Links to all GeneRIF Items

3082

Links to iHOP

3082

Sequence Information

Nucleotide Sequence

>3082 : length: 2187
atgtgggtgaccaaactcctgccagccctgctgctgcagcatgtcctcctgcatctcctc
ctgctccccatcgccatcccctatgcagagggacaaaggaaaagaagaaatacaattcat
gaattcaaaaaatcagcaaagactaccctaatcaaaatagatccagcactgaagataaaa
accaaaaaagtgaatactgcagaccaatgtgctaatagatgtactaggaataaaggactt
ccattcacttgcaaggcttttgtttttgataaagcaagaaaacaatgcctctggttcccc
ttcaatagcatgtcaagtggagtgaaaaaagaatttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggacgcagctacaagggaacagta
tctatcactaagagtggcatcaaatgtcagccctggagttccatgataccacacgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggagagttatcga
ggtctcatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgcctgaaagatatcccgacaagggctttgatgataattattgc
cgcaatcccgatggccagccgaggccatggtgctatactcttgaccctcacacccgctgg
gagtactgtgcaattaaaacatgcgctgacaatactatgaatgacactgatgttcctttg
gaaacaactgaatgcatccaaggtcaaggagaaggctacaggggcactgtcaataccatt
tggaatggaattccatgtcagcgttgggattctcagtatcctcacgagcatgacatgact
cctgaaaatttcaagtgcaaggacctacgagaaaattactgccgaaatccagatgggtct
gaatcaccctggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaactgtgatatgtcacatggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaacttatcccaaacaagatctggactaacatgttcaatgtgggacaagaacatggaa
gacttacatcgtcatatcttctgggaaccagatgcaagtaagctgaatgagaattactgc
cgaaatccagatgatgatgctcatggaccctggtgctacacgggaaatccactcattcct
tgggattattgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcccgtaatatcttgtgccaaaacgaaacaattgcgagttgtaaatgggattcca
acacgaacaaacataggatggatggttagtttgagatacagaaataaacatatctgcgga
ggatcattgataaaggagagttgggttcttactgcacgacagtgtttcccttctcgagac
ttgaaagattatgaagcttggcttggaattcatgatgtccacggaagaggagatgagaaa
tgcaaacaggttctcaatgtttcccagctggtatatggccctgaaggatcagatctggtt
ttaatgaagcttgccaggcctgctgtcctggatgattttgttagtacgattgatttacct
aattatggatgcacaattcctgaaaagaccagttgcagtgtttatggctggggctacact
ggattgatcaactatgatggcctattacgagtggcacatctctatataatgggaaatgag
aaatgcagccagcatcatcgagggaaggtgactctgaatgagtctgaaatatgtgctggg
gctgaaaagattggatcaggaccatgtgagggggattatggtggcccacttgtttgtgag
caacataaaatgagaatggttcttggtgtcattgttcctggtcgtggatgtgccattcca
aatcgtcctggtatttttgtccgagtagcatattatgcaaaatggatacacaaaattatt
ttaacatataaggtaccacagtcatag

Protein Sequence

>3082 : length: 728
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS



')