Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3068

Name

HDGF

Synonym

HMG1L2;hepatoma-derived growth factor;HDGF;hepatoma-derived growth factor

Definition

HMG-1L2|high mobility group protein 1-like 2

Position

1q21-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Diabetes pathways;Reactome;REACT:15380

External Links

Links to Entrez Gene

3068

Links to all GeneRIF Items

3068

Links to iHOP

3068

Sequence Information

Nucleotide Sequence

>3068 : length: 771
atgcacccggaaggtggccaatttgtgcctcaactccttggccatctcctggctaccaaa
ctcaagcgtttcctccttagcaaaggcggacgtagggctcaaatccccgacgtttccagg
gccaccccccatacgattgacgagatgcctgaggctgccgtgaaatcaacagccaacaaa
taccaagtcttttttttcgggacccacgagacggcattcctgggccccaaagacctcttc
ccttacgaggaatccaaggagaagtttggcaagcccaacaagaggaaagggttcagcgag
gggctgtgggagatcgagaacaaccctactgtcaaggcttccggctatcagtcctcccag
aaaaagagctgtgtggaagagcctgaaccagagcccgaagctgcagagggtgacggtgat
aagaaggggaatgcagagggcagcagcgacgaggaagggaagctggtcattgatgagcca
gccaaggagaagaacgagaaaggagcgttgaagaggagagcaggggacttgctggaggac
tctcctaaacgtcccaaggaggcagaaaaccctgaaggagaggagaaggaggcagccacc
ttggaggttgagaggccccttcctatggaggtggaaaagaatagcaccccctctgagccc
ggctctggccgggggcctccccaagaggaagaagaagaggaggatgaagaggaagaggct
accaaggaagatgctgaggccccaggcatcagagatcatgagagcctgtag

Protein Sequence

>3068 : length: 256
MHPEGGQFVPQLLGHLLATKLKRFLLSKGGRRAQIPDVSRATPHTIDEMPEAAVKSTANK
YQVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQ
KKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNEKGALKRRAGDLLED
SPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEA
TKEDAEAPGIRDHESL



')