Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2934

Name

GSN

Synonym

ADF|AGEL;gelsolin;GSN;gelsolin

Definition

actin-depolymerizing factor|brevin

Position

9q33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

rho cell motility signaling pathway;PID BioCarta;100041

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

EGF receptor (ErbB1) signaling pathway;PID Curated;200085

Pathway

Caspase-mediated cleavage of cytoskeletal proteins;PID Reactome;500271

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

FAS signaling pathway;PANTHER;P00020

Disease

Amyloidosis, Finnish type;OMIM

External Links

Links to Entrez Gene

2934

Links to all GeneRIF Items

2934

Links to iHOP

2934

Sequence Information

Nucleotide Sequence

>2934 : length: 2349
atggctccgcaccgccccgcgcccgcgctgctttgcgcgctgtccctggcgctgtgcgcg
ctgtcgctgcccgtccgcgcggccactgcgtcgcggggggcgtcccaggcgggggcgccc
caggggcgggtgcccgaggcgcggcccaacagcatggtggtggaacaccccgagttcctc
aaggcagggaaggagcctggcctgcagatctggcgtgtggagaagttcgatctggtgccc
gtgcccaccaacctttatggagacttcttcacgggcgacgcctacgtcatcctgaagaca
gtgcagctgaggaacggaaatctgcagtatgacctccactactggctgggcaatgagtgc
agccaggatgagagcggggcggccgccatctttaccgtgcagctggatgactacctgaac
ggccgggccgtgcagcaccgtgaggtccagggcttcgagtcggccaccttcctaggctac
ttcaagtctggcctgaagtacaagaaaggaggtgtggcatcaggattcaagcacgtggta
cccaacgaggtggtggtgcagagactcttccaggtcaaagggcggcgtgtggtccgtgcc
accgaggtacctgtgtcctgggagagcttcaacaatggcgactgcttcatcctggacctg
ggcaacaacatccaccagtggtgtggttccaacagcaatcggtatgaaagactgaaggcc
acacaggtgtccaagggcatccgggacaacgagcggagtggccgggcccgagtgcacgtg
tctgaggagggcactgagcccgaggcgatgctccaggtgctgggccccaagccggctctg
cctgcaggtaccgaggacaccgccaaggaggatgcggccaaccgcaagctggccaagctc
tacaaggtctccaatggtgcagggaccatgtccgtctccctcgtggctgatgagaacccc
ttcgcccagggggccctgaagtcagaggactgcttcatcctggaccacggcaaagatggg
aaaatctttgtctggaaaggcaagcaggcaaacacggaggagaggaaggctgccctcaaa
acagcctctgacttcatcaccaagatggactaccccaagcagactcaggtctcggtcctt
cctgagggcggtgagaccccactgttcaagcagttcttcaagaactggcgggacccagac
cagacagatggcctgggcttgtcctacctttccagccatatcgccaacgtggagcgggtg
cccttcgacgccgccaccctgcacacctccactgccatggccgcccagcacggcatggat
gacgatggcacaggccagaaacagatctggagaatcgaaggttccaacaaggtgcccgtg
gaccctgccacatatggacagttctatggaggcgacagctacatcattctgtacaactac
cgccatggtggccgccaggggcagataatctataactggcagggtgcccagtctacccag
gatgaggtcgctgcatctgccatcctgactgctcagctggatgaggagctgggaggtacc
cctgtccagagccgtgtggtccaaggcaaggagcccgcccacctcatgagcctgtttggt
gggaagcccatgatcatctacaagggcggcacctcccgcgagggcgggcagacagcccct
gccagcacccgcctcttccaggtccgcgccaacagcgctggagccacccgggctgttgag
gtattgcctaaggctggtgcactgaactccaacgatgcctttgttctgaaaaccccctca
gccgcctacctgtgggtgggtacaggagccagcgaggcagagaagacgggggcccaggag
ctgctcagggtgctgcgggcccaacctgtgcaggtggcagaaggcagcgagccagatggc
ttctgggaggccctgggcgggaaggctgcctaccgcacatccccacggctgaaggacaag
aagatggatgcccatcctcctcgcctctttgcctgctccaacaagattggacgttttgtg
atcgaagaggttcctggtgagctcatgcaggaagacctggcaacggatgacgtcatgctt
ctggacacctgggaccaggtctttgtctgggttggaaaggattctcaagaagaagaaaag
acagaagccttgacttctgctaagcggtacatcgagacggacccagccaatcgggatcgg
cggacgcccatcaccgtggtgaagcaaggctttgagcctccctcctttgtgggctggttc
cttggctgggatgatgattactggtctgtggaccccttggacagggccatggctgagctg
gctgcctga

Protein Sequence

>2934 : length: 782
MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFL
KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNEC
SQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVV
PNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKA
TQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL
YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALK
TASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY
RHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFG
GKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS
AAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDK
KMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEK
TEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAEL
AA



')