Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2932

Name

GSK3B

Synonym

-;glycogen synthase kinase 3 beta;GSK3B;glycogen synthase kinase 3 beta

Definition

GSK-3 beta|GSK3beta isoform|glycogen synthase kinase-3 beta|serine/threonine-protein kinase GSK3B

Position

3q13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Aurora A signaling;PID Curated;200166

Pathway

LKB1 signaling events;PID Curated;200061

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

Alzheimer's disease;KEGG PATHWAY;hsa05010

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

segmentation clock;PID BioCarta;100146

Pathway

C-MYC pathway;PID Curated;200093

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

CRMPs in Sema3A signaling;PID Reactome;500077

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

regulation of eif2;PID BioCarta;100179

Pathway

Signaling by Wnt;Reactome;REACT:11045

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Insulin-mediated glucose transport;PID Curated;200168

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway;PANTHER;P00026

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Ras Pathway;PANTHER;P04393

Pathway

p53 pathway;PID Curated;200175

Pathway

nfat and hypertrophy of the heart ;PID BioCarta;100098

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

deregulation of cdk5 in alzheimers disease;PID BioCarta;100086

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

Hedgehog signaling pathway;PANTHER;P00025

Disease

bipolar disorder;GAD

Disease

PSYCH;GAD

Disease

Alzheimers disease;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to Entrez Gene

2932

Links to all GeneRIF Items

2932

Links to iHOP

2932

Sequence Information

Nucleotide Sequence

>2932 : length: 1263
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggacggcagcaaggtgacaacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggtcgccatcaagaaagtattgcaggacaagagatttaagaatcgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccgcagaacctcttgttggatcctgatactgctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggat
agtggtgtggatcagttggtagaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggactaaggtcttccgaccccgaactccaccggaggcaattgcactgtgtagccgtctg
ctggagtatacaccaactgcccgactaacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctggctaccatccttattcctcct
catgctcggattcaagcagctgcttcaacccccacaaatgccacagcagcgtcagatgct
aatactggagaccgtggacagaccaataatgctgcttctgcatcagcttccaactccacc
tga

Protein Sequence

>2932 : length: 420
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST



')