Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2931

Name

GSK3A

Synonym

-;glycogen synthase kinase 3 alpha;GSK3A;glycogen synthase kinase 3 alpha

Definition

GSK-3 alpha|glycogen synthase kinase-3 alpha|serine/threonine-protein kinase GSK3A

Position

19q13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway;PANTHER;P00026

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

FOXM1 transcription factor network;PID Curated;200120

External Links

Links to Entrez Gene

2931

Links to all GeneRIF Items

2931

Links to iHOP

2931

Sequence Information

Nucleotide Sequence

>2931 : length: 1452
atgagcggcggcgggccttcgggaggcggccctgggggctcgggcagggcgcggactagc
tcgttcgcggagcccggcggcggaggcggaggaggcggcggcggccccggaggctcggcc
tccggcccaggcggcaccggcggcggaaaggcatctgtcggggccatgggtgggggcgtc
ggggcctcgagctccgggggtggacccggcggcagcggcggaggaggcagcggaggcccc
ggcgcaggcactagcttcccgccgcccggggtgaagctgggccgtgacagcgggaaggtg
accacagtcgtagccactctaggccaaggcccagagcgctcccaagaagtggcttacacg
gacatcaaagtgattggcaatggctcatttggggtcgtgtaccaggcacggctggcagag
accagggaactagtcgccatcaagaaggttctccaggacaagaggttcaagaaccgagag
ctgcagatcatgcgtaagctggaccactgcaatattgtgaggctgagatactttttctac
tccagtggcgagaagaaagacgagctttacctaaatctggtgctggaatatgtgcccgag
acagtgtaccgggtggcccgccacttcaccaaggccaagttgaccatccctatcctctat
gtcaaggtgtacatgtaccagctcttccgcagcttggcctacatccactcccagggcgtg
tgtcaccgcgacatcaagccccagaacctgctggtggaccctgacactgctgtcctcaag
ctctgcgattttggcagtgcaaagcagttggtccgaggggagcccaatgtctcctacatc
tgttctcgctactaccgggccccagagctcatctttggagccactgattacacctcatcc
atcgatgtttggtcagctggctgtgtactggcagagctcctcttgggccagcccatcttc
cctggggacagtggggtggaccagctggtggagatcatcaaggtgctgggaacaccaacc
cgggaacaaatccgagagatgaaccccaactacacggagttcaagttccctcagattaaa
gctcacccctggacaaaggtgttcaaatctcgaacgccgccagaggccatcgcgctctgc
tctagcctgctggagtacaccccatcctcaaggctctccccactagaggcctgtgcgcac
agcttctttgatgaactgcgatgtctgggaacccagctgcctaacaaccgcccacttccc
cctctcttcaacttcagtgctggtgaactctccatccaaccgtctctcaacgccattctc
atccctcctcacttgaggtccccagcgggcactaccaccctcaccccgtcctcacaagct
ttaactgagactccgaccagctcagactggcagtcgaccgatgccacacctaccctcact
aactcctcctga

Protein Sequence

>2931 : length: 483
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT
DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV
CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS
IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK
AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT
NSS



')