Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

29126

Name

CD274

Synonym

B7-H|B7H1|PD-L1|PDCD1L1|PDCD1LG1|PDL1;CD274 molecule;CD274;CD274 molecule

Definition

B7 homolog 1|CD274 antigen|PDCD1 ligand 1|programmed cell death 1 ligand 1|programmed death ligand 1

Position

9p24

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514

Pathway

Signaling in Immune system;Reactome;REACT:6900

Disease

Autoimmune disease;FunDO

Disease

Lupus erythematosus;FunDO

Disease

Embryoma;FunDO

Disease

Stomach cancer;FunDO

Disease

Hepatitis B;FunDO

Disease

diabetes, type 1;GAD

Disease

Dermatitis;FunDO

Disease

Sicca syndrome;FunDO

Disease

Hodgkin's disease;FunDO

Disease

Esophageal tumor;FunDO

Disease

Ovarian cancer;FunDO

Disease

Helicobacter infection;FunDO

Disease

Hepatitis C;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Kidney disease;FunDO

Disease

Graves' disease;FunDO

Disease

HIV infection;FunDO

Disease

Malignant glioma;FunDO

Disease

Breast cancer;FunDO

Disease

Bladder cancer;FunDO

Disease

IMMUNE;GAD

External Links

Links to Entrez Gene

29126

Links to all GeneRIF Items

29126

Links to iHOP

29126

Sequence Information

Nucleotide Sequence

>29126 : length: 873
atgaggatatttgctgtctttatattcatgacctactggcatttgctgaacgcatttact
gtcacggttcccaaggacctatatgtggtagagtatggtagcaatatgacaattgaatgc
aaattcccagtagaaaaacaattagacctggctgcactaattgtctattgggaaatggag
gataagaacattattcaatttgtgcatggagaggaagacctgaaggttcagcatagtagc
tacagacagagggcccggctgttgaaggaccagctctccctgggaaatgctgcacttcag
atcacagatgtgaaattgcaggatgcaggggtgtaccgctgcatgatcagctatggtggt
gccgactacaagcgaattactgtgaaagtcaatgccccatacaacaaaatcaaccaaaga
attttggttgtggatccagtcacctctgaacatgaactgacatgtcaggctgagggctac
cccaaggccgaagtcatctggacaagcagtgaccatcaagtcctgagtggtaagaccacc
accaccaattccaagagagaggagaagcttttcaatgtgaccagcacactgagaatcaac
acaacaactaatgagattttctactgcacttttaggagattagatcctgaggaaaaccat
acagctgaattggtcatcccagaactacctctggcacatcctccaaatgaaaggactcac
ttggtaattctgggagccatcttattatgccttggtgtagcactgacattcatcttccgt
ttaagaaaagggagaatgatggatgtgaaaaaatgtggcatccaagatacaaactcaaag
aagcaaagtgatacacatttggaggagacgtaa

Protein Sequence

>29126 : length: 290
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET



')