Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2902

Name

GRIN1

Synonym

MRD8|NMDA1|NMDAR1|NR1;glutamate receptor, ionotropic, N-methyl D-aspartate 1;GRIN1;glutamate receptor, ionotropic, N-methyl D-aspartate 1

Definition

N-methyl-D-aspartate receptor channel, subunit zeta-1|N-methyl-D-aspartate receptor subunit NR1|NMD-R1|glutamate [NMDA] receptor subunit zeta 1|glutamate [NMDA] receptor subunit zeta-1

Position

9q34.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080

Pathway

Metabotropic glutamate receptor group III pathway;PANTHER;P00039

Pathway

Long-term potentiation;KEGG PATHWAY;hsa04720

Pathway

Muscarinic acetylcholine receptor 1 and 3 signaling pathway;PANTHER;P00042

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

Ionotropic glutamate receptor pathway;PANTHER;P00037

Pathway

Synaptic Transmission;Reactome;REACT:13685

Pathway

Alzheimer's disease;KEGG PATHWAY;hsa05010

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

Huntington's disease;KEGG PATHWAY;hsa05016

Pathway

Huntington disease;PANTHER;P00029

Pathway

Metabotropic glutamate receptor group I pathway;PANTHER;P00041

Disease

PSYCH;GAD

Disease

CHEMDEPENDENCY;GAD

Disease

alcoholism-related traits;GAD

Disease

schizophrenia;GAD

Disease

seizures;GAD

Disease

alcoholism;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to Entrez Gene

2902

Links to all GeneRIF Items

2902

Links to iHOP

2902

Sequence Information

Nucleotide Sequence

>2902 : length: 2658
atgagcaccatgcgcctgctgacgctcgccctgctgttctcctgctccgtcgcccgtgcc
gcgtgcgaccccaagatcgtcaacattggcgcggtgctgagcacgcggaagcacgagcag
atgttccgcgaggccgtgaaccaggccaacaagcggcacggctcctggaagattcagctc
aatgccacctccgtcacgcacaagcccaacgccatccagatggctctgtcggtgtgcgag
gacctcatctccagccaggtctacgccatcctagttagccatccacctacccccaacgac
cacttcactcccacccctgtctcctacacagccggcttctaccgcatacccgtgctgggg
ctgaccacccgcatgtccatctactcggacaagagcatccacctgagcttcctgcgcacc
gtgccgccctactcccaccagtccagcgtgtggtttgagatgatgcgtgtctacagctgg
aaccacatcatcctgctggtcagcgacgaccacgagggccgggcggctcagaaacgcctg
gagacgctgctggaggagcgtgagtccaaggcagagaaggtgctgcagtttgacccaggg
accaagaacgtgacggccctgctgatggaggcgaaagagctggaggcccgggtcatcatc
ctttctgccagcgaggacgatgctgccactgtataccgcgcagccgcgatgctgaacatg
acgggctccgggtacgtgtggctggtcggcgagcgcgagatctcggggaacgccctgcgc
tacgccccagacggcatcctcgggctgcagctcatcaacggcaagaacgagtcggcccac
atcagcgacgccgtgggcgtggtggcccaggccgtgcacgagctcctcgagaaggagaac
atcaccgacccgccgcggggctgcgtgggcaacaccaacatctggaagaccgggccgctc
ttcaagagagtgctgatgtcttccaagtatgcggatggggtgactggtcgcgtggagttc
aatgaggatggggaccggaagttcgccaactacagcatcatgaacctgcagaaccgcaag
ctggtgcaagtgggcatctacaatggcacccacgtcatccctaatgacaggaagatcatc
tggccaggcggagagacagagaagcctcgagggtaccagatgtccaccagactgaagatt
gtgacgatccaccaggagcccttcgtgtacgtcaagcccacgctgagtgatgggacatgc
aaggaggagttcacagtcaacggcgacccagtcaagaaggtgatctgcaccgggcccaac
gacacgtcgccgggcagcccccgccacacggtgcctcagtgttgctacggcttttgcatc
gacctgctcatcaagctggcacggaccatgaacttcacctacgaggtgcacctggtggca
gatggcaagttcggcacacaggagcgggtgaacaacagcaacaagaaggagtggaatggg
atgatgggcgagctgctcagcgggcaggcagacatgatcgtggcgccgctaaccataaac
aacgagcgcgcgcagtacatcgagttttccaagcccttcaagtaccagggcctgactatt
ctggtcaagaaggagattccccggagcacgctggactcgttcatgcagccgttccagagc
acactgtggctgctggtggggctgtcggtgcacgtggtggccgtgatgctgtacctgctg
gaccgcttcagccccttcggccggttcaaggtgaacagcgaggaggaggaggaggacgca
ctgaccctgtcctcggccatgtggttctcctggggcgtcctgctcaactccggcatcggg
gaaggcgcccccagaagcttctcagcgcgcatcctgggcatggtgtgggccggctttgcc
atgatcatcgtggcctcctacaccgccaacctggcggccttcctggtgctggaccggccg
gaggagcgcatcacgggcatcaacgaccctcggctgaggaacccctcggacaagtttatc
tacgccacggtgaagcagagctccgtggatatctacttccggcgccaggtggagctgagc
accatgtaccggcatatggagaagcacaactacgagagtgcggcggaggccatccaggcc
gtgagagacaacaagctgcatgccttcatctgggactcggcggtgctggagttcgaggcc
tcgcagaagtgcgacctggtgacgactggagagctgtttttccgctcgggcttcggcata
ggcatgcgcaaagacagcccctggaagcagaacgtctccctgtccatcctcaagtcccac
gagaatggcttcatggaagacctggacaagacgtgggttcggtatcaggaatgtgactcg
cgcagcaacgcccctgcgacccttacttttgagaacatggccggggtcttcatgctggta
gctgggggcatcgtggccgggatcttcctgattttcatcgagattgcctacaagcggcac
aaggatgctcgccggaagcagatgcagctggcctttgccgccgttaacgtgtggcggaag
aacctgcagcagtaccatcccactgatatcacgggcccgctcaacctctcagatccctcg
gtcagcaccgtggtgtga

Protein Sequence

>2902 : length: 885
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQQYHPTDITGPLNLSDPSVSTVV



')