Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

290

Name

ANPEP

Synonym

APN|CD13|GP150|LAP1|P150|PEPN;alanyl (membrane) aminopeptidase;ANPEP;alanyl (membrane) aminopeptidase

Definition

AP-M|AP-N|alanyl aminopeptidase|aminopeptidase M|aminopeptidase N|hAPN|microsomal aminopeptidase|myeloid plasma membrane glycoprotein CD13

Position

15q25-q26

Gene Type

protein-coding

Pathways and Diseases

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Glutathione metabolism;KEGG PATHWAY;hsa00480

Pathway

Renin-angiotensin system;KEGG PATHWAY;hsa04614

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

gamma-glutamyl cycle;BioCyc;PWY-4041

Disease

Coronavirus infection;FunDO

Disease

Infection;FunDO

Disease

Hypertension;FunDO

Disease

Cancer;FunDO

Disease

Acne;FunDO

External Links

Links to Entrez Gene

290

Links to all GeneRIF Items

290

Links to iHOP

290

Sequence Information

Nucleotide Sequence

>290 : length: 2904
atggccaagggcttctatatttccaagtccctgggcatcctggggatcctcctgggcgtg
gcagccgtgtgcacaatcatcgcactgtcagtggtgtactcccaggagaagaacaagaac
gccaacagctcccccgtggcctccaccaccccgtccgcctcagccaccaccaaccccgcc
tcggccaccaccttggaccaaagtaaagcgtggaatcgttaccgcctccccaacacgctg
aaacccgattcctaccgggtgacgctgagaccgtacctcacccccaatgacaggggcctg
tacgtttttaagggctccagcaccgtccgtttcacctgcaaggaggccactgacgtcatc
atcatccacagcaagaagctcaactacaccctcagccaggggcacagggtggtcctgcgt
ggtgtgggaggctcccagccccccgacattgacaagactgagctggtggagcccaccgag
tacctggtggtgcacctcaagggctccctggtgaaggacagccagtatgagatggacagc
gagttcgagggggagttggcagatgacctggcgggcttctaccgcagcgagtacatggag
ggcaatgtcagaaaggtggtggccactacacagatgcaggctgcagatgcccggaagtcc
ttcccatgcttcgatgagccggccatgaaggccgagttcaacatcacgcttatccacccc
aaggacctgacagccctgtccaacatgcttcccaaaggtcccagcaccccacttccagaa
gaccccaactggaatgtcactgagttccacaccacgcccaagatgtccacgtacttgctg
gccttcattgtcagtgagttcgactacgtggagaagcaggcatccaatggtgtcttgatc
cggatctgggcccggcccagtgccattgcggcgggccacggcgattatgccctgaacgtg
acgggccccatccttaacttctttgctggtcattatgacacaccctacccactcccaaaa
tcagaccagattggcctgccagacttcaacgccggcgccatggagaactggggactggtg
acctaccgggagaactccctgctgttcgaccccctgtcctcctccagcagcaacaaggag
cgggtggtcactgtgattgctcatgagctggcccaccagtggttcgggaacctggtgacc
atagagtggtggaatgacctgtggctgaacgagggcttcgcctcctacgtggagtacctg
ggtgctgactatgcggagcccacctggaacttgaaagacctcatggtgctgaatgatgtg
taccgcgtgatggcagtggatgcactggcctcctcccacccgctgtccacacccgcctcg
gagatcaacacgccggcccagatcagtgagctgtttgacgccatctcctacagcaagggc
gcctcagtcctcaggatgctctccagcttcctgtccgaggacgtattcaagcagggcctg
gcgtcctacctccacacctttgcctaccagaacaccatctacctgaacctgtgggaccac
ctgcaggaggctgtgaacaaccggtccatccaactccccaccaccgtgcgggacatcatg
aaccgctggaccctgcagatgggcttcccggtcatcacggtggataccagcacggggacc
ctttcccaggagcacttcctccttgaccccgattccaatgttacccgcccctcagaattc
aactacgtgtggattgtgcccatcacatccatcagagatggcagacagcagcaggactac
tggctgatagatgtaagagcccagaacgatctcttcagcacatcaggcaatgagtgggtc
ctgctgaacctcaatgtgacgggctattaccgggtgaactacgacgaagagaactggagg
aagattcagactcagctgcagagagaccactcggccatccctgtcatcaatcgggcacag
atcattaatgacgccttcaacctggccagtgcccataaggtccctgtcactctggcgctg
aacaacaccctcttcctgattgaagagagacagtacatgccctgggaggccgccctgagc
agcctgagctacttcaagctcatgtttgaccgctccgaggtctatggccccatgaagaac
tacctgaagaagcaggtcacacccctcttcattcacttcagaaataataccaacaactgg
agggagatcccagaaaacctgatggaccagtacagcgaggttaatgccatcagcaccgcc
tgctccaacggagttccagagtgtgaggagatggtctctggccttttcaagcagtggatg
gagaaccccaataataacccgatccaccccaacctgcggtccaccgtctactgcaacgct
atcgcccagggcggggaggaggagtgggacttcgcctgggagcagttccgaaatgccaca
ctggtcaatgaggctgacaagctccgggcagccctggcctgcagcaaagagttgtggatc
ctgaacaggtacctgagctacaccctgaacccggacttaatccggaagcaggacgccacc
tctaccatcatcagcattaccaacaacgtcattgggcaaggtctggtctgggactttgtc
cagagcaactggaagaagctttttaacgattatggtggtggctcgttctccttctccaac
ctcatccaggcagtgacacgacgattctccaccgagtatgagctgcagcagctggagcag
ttcaagaaggacaacgaggaaacaggcttcggctcaggcacccgggccctggagcaagcc
ctggagaagacgaaagccaacatcaagtgggtgaaggagaacaaggaggtggtgctccag
tggttcacagaaaacagcaaatag

Protein Sequence

>290 : length: 967
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI
IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS
EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP
KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV
TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG
ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM
NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ
IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN
YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM
ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ
WFTENSK



')