Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

28984

Name

C13orf15

Synonym

RGC-32|RGC32|bA157L14.2;chromosome 13 open reading frame 15;C13orf15;chromosome 13 open reading frame 15

Definition

response gene to complement 32 protein

Position

13q14.11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Direct p53 effectors;PID Curated;200101

External Links

Links to Entrez Gene

28984

Links to all GeneRIF Items

28984

Links to iHOP

28984

Sequence Information

Nucleotide Sequence

>28984 : length: 414
atgaagccgcccgcggcgcagggcagccccgcggccgccgcggccgcagccccggccctg
gactcggcggccgcggaggacctgtcggacgcgctgtgcgagtttgacgcggtgctggcc
gacttcgcgtcgcccttccacgagcgccacttccactacgaggagcacctggagcgcatg
aagcggcgcagcagcgccagtgtcagcgacagcagcggcttcagcgactcggagagtgca
gattcactttataggaacagcttcagcttcagtgatgaaaaactgaattctccaacagac
tctaccccagctcttctctctgccactgtcactcctcagaaagctaaattaggagacaca
aaagagctagaagccttcattgctgatcttgacaaaactttagcaagtatgtga

Protein Sequence

>28984 : length: 137
MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERM
KRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDT
KELEAFIADLDKTLASM



')