Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

284217

Name

LAMA1

Synonym

LAMA|S-LAM-alpha;laminin, alpha 1;LAMA1;laminin, alpha 1

Definition

S-LAM alpha|S-laminin subunit alpha|laminin A chain|laminin subunit alpha-1|laminin-3 subunit alpha

Position

18p11.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Glypican 1 network;PID Curated;200021

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Disease

Rabies;FunDO

Disease

Endometriosis;FunDO

Disease

Alzheimer's disease;FunDO

Disease

smoking cessation;GAD

Disease

CHEMDEPENDENCY;GAD

External Links

Links to Entrez Gene

284217

Links to all GeneRIF Items

284217

Links to iHOP

284217

Sequence Information

Nucleotide Sequence

>284217 : length: 9228
atgcgcgggggcgtgctcctggtcttgctgctgtgtgtcgccgcgcagtgccggcagaga
ggcctgtttcctgccattctcaatcttgccagcaatgctcacatcagcaccaatgccacc
tgtggcgagaaggggccggagatgttctgcaaacttgtggagcatgtgccaggtcggccc
gtccgaaacccacagtgccggatctgtgatggcaacagcgcaaaccccagagaacgccat
ccaatatcacatgccatagatggcaccaataactggtggcaaagtcccagcattcagaat
gggagagaatatcactgggtcacaatcactctggacttaagacaggtctttcaagttgca
tatgtcatcattaaagctgccaatgcccctcgacctggaaactggattttggagcgttct
ctggatggcaccacgttcagcccctggcagtattatgcagtcagcgactcagagtgtttg
tctcgttacaatataactccaagacgagggccacccacctacagggctgatgatgaagtg
atctgcacctcctattattccagattggtgccacttgagcatggagagattcatacatca
ctcatcaatggcagaccaagcgctgacgatctttcacccaagttgttggaattcacttct
gcacgatatattcgccttcgcttgcaacgcattagaacgctcaatgcagatctcatgacc
cttagccaccgggaacctaaagaactggatcctattgttaccagacgctattattattca
ataaaggacatttctgttggaggcatgtgtatctgctatggccatgctagtagctgccca
tgggatgaaactacaaagaaactgcagtgtcaatgtgagcataatacttgcggggagagc
tgtaacaggtgctgtcctgggtaccatcagcagccctggaggccgggaaccgtgtcctcc
ggcaatacatgtgaagcatgtaattgtcacaataaagccaaagactgttactatgatgaa
agtgttgcaaagcagaagaaaagtttgaatactgctggacagttcagaggaggaggggtt
tgcataaattgcttgcagaacaccatgggaatcaactgtgaaacctgtattgatggatat
tatagaccacacaaagtgtctccttatgaggatgagccttgccgcccctgtaattgtgac
cctgtggggtccctcagttctgtctgtattaaggatgacctccattctgacttacacaat
gggaagcagccaggtcagtgcccatgtaaggaaggttatacaggagaaaaatgtgatcgc
tgccaacttggctataaggattacccgacctgtgtctcctgtgggtgcaacccagtgggc
agtgccagtgatgagccctgcacagggccctgtgtttgtaaggaaaacgttgaggggaag
gcctgtgatcgctgcaagccaggattctataacttgaaggaaaaaaacccccggggctgc
tccgagtgcttctgctttggcgtttctgatgtctgcagcagcctctcttggcctgttggt
caggtaaacagtatgtccgggtggctggtcaccgacttgatcagtcccaggaagatcccg
tctcagcaagatgcactaggcgggcgccatcaggtcagcatcaacaacaccgcggtcatg
cagagactggctcccaagtactactgggcagcccccgaggcctaccttggaaataagctg
actgcgtttggcggattcctgaaatacacggtgtcctacgatattccggtagagacggta
gacagtaacctcatgtcgcatgctgacgtcatcattaagggaaacggactcactttaagc
acacaggctgagggtctgtcattgcagccttatgaagagtacctaaacgtggttagactt
gtgcctgaaaacttccaagattttcacagcaaaaggcagattgatcgtgaccagctgatg
actgtccttgccaatgtgacacatcttttgatcagagccaactacaattctgcaaaaatg
gctctttacaggttggagtccgtctctctggacatagccagctctaatgccatcgacctg
gtggtggccgctgatgtggagcactgtgaatgtccgcaaggctacacagggacctcctgt
gagtcgtgcctctctggctattaccgcgtggatggaatactctttggaggaatttgtcaa
ccctgtgaatgccacggccatgcagctgagtgtaatgttcacggcgtttgcattgcgtgt
gcgcacaacaccaccggcgtccactgtgagcagtgcttgcccggcttctacggggagcct
tcccgagggacacctggggactgccagccctgcgcctgccctctcaccatagcctccaac
aatttcagccccacctgccacctcaatgatggagatgaagtggtctgtgactggtgtgcc
ccgggctactcaggagcttggtgtgagagatgtgcagatggttactatggaaacccaaca
gtgcctggcgaatcttgtgttccctgtgactgcagcggcaacgtggacccctcggaggct
ggtcactgtgactcagtcaccggggagtgcctgaagtgcctggggaacacagatggcgcc
cactgtgaaaggtgtgctgacgggttctatggggacgctgtgacagccaagaactgccgc
gcctgtgaatgccatgtgaaaggctcccattctgccgtgtgccatcttgagaccgggctc
tgtgactgcaaaccaaacgtgactggacagcagtgtgaccagtgcttgcatggctattat
gggctggactcaggccatggctgccggccctgcaactgcagcgtggcaggctccgtgtca
gatggctgcacggatgaaggccagtgtcactgtgtcccaggtgtggcagggaaaaggtgt
gacaggtgtgcccatggcttctacgcctaccaggatggtagctgtacaccctgtgactgc
ccacacactcagaatacctgcgacccagaaactggagagtgtgtctgcccccctcacaca
cagggtgtgaagtgtgaagaatgtgaggatgggcactggggctacgatgcggaggtgggg
tgccaggcctgcaattgcagtctcgtggggtcgactcatcatcggtgcgatgtggtcacc
ggccattgccagtgcaagtcaaaatttggtggccgggcctgcgatcagtgttccttgggt
tacagagactttcccgactgtgttccctgtgactgtgacctgagggggacgtcgggggac
gcctgcaacctggagcagggtctctgcggctgtgtggaggaaaccggggcctgcccttgc
aaggaaaatgtctttggtcctcagtgcaacgaatgtcgagagggcaccttcgctctccgc
gcagacaaccccctgggctgcagcccgtgcttctgctccgggctgtcccacctctgctca
gagctggaggactacgtgaggaccccagtaacgctgggctccgatcagcctcttctgcgt
gtggtttctcagagtaacttgaggggcacgaccgagggggtttactaccaggcccccgac
ttcctgctggatgccgccaccgtccggcagcacatccgtgcagagccgttttactggcgg
ctgccgcagcagttccaaggagaccagctcatggcctatggtggcaaactgaagtacagc
gtggccttctattctttggatggcgtcggcacctccaattttgagcctcaagttctcatc
aaaggtggtcggatcagaaagcaagtcatttacatggatgcaccagccccagagaatgga
gtgagacaggaacaagaagtagcaatgagagagaatttttggaaatattttaactctgtt
tctgaaaaacctgtcacgcgagaggattttatgtctgtcctcagcgatattgagtacatc
ctcatcaaggcatcgtatggtcaaggattacagcagagcagaatctcagacatttcaatg
gaggttggcagaaaggctgaaaagctgcacccagaagaagaggttgcatctcttttagag
aattgtgtctgtcctcctggcactgtgggattctcatgtcaggactgcgcccctgggtac
cacagagggaagctcccagcagggagtgacaggggaccacgccctctggttgctccttgt
gttccctgcagttgcaacaaccacagtgacacctgtgaccccaacaccgggaagtgtctg
aactgtggcgataacacagcaggtgaccattgtgatgtgtgtacttctggctactacggg
aaggtgactggctcagcaagtgactgtgctctgtgtgcctgtcctcacagccctcctgcc
agttttagtcccacttgtgtcttggaaggggaccacgatttccgttgtgacgcctgtctc
ctgggctatgaaggaaaacactgtgaaaggtgctcctcaagctattatgggaaccctcaa
acaccaggtggcagttgccagaagtgtgactgcaacccgcacggctctgtccacggtgac
tgtgaccgcacatctgggcagtgcgtttgcaggctgggggcctcggggctccggtgcgat
gagtgtgaaccgaggcacattctgatggaaacagattgtgtttcctgtgatgatgagtgt
gtaggtgtgctgctgaatgacttggatgagattggtgatgccgttctttctctgaacctc
actggcattatccctgtcccatatggaattttgtcaaacctggaaaatacaactaaatat
ctccaggaatctttattaaaagaaaatatgcaaaaggacctgggaaaaattaagcttgaa
ggtgttgcagaagaaacggacaacctgcaaaagaagctcactaggatgttagcgagtacc
caaaaggtgaatagggcaactgagagaatcttcaaggagagtcaagacctggccatagcc
attgagaggctgcagatgagcatcacagaaattatggaaaagacaactttaaatcagact
ttggatgaagatttcctactacccaattctactcttcagaacatgcaacagaatggtaca
tctttgctagaaatcatgcagataagagacttcacacagttgcaccaaaatgccaccctt
gaactcaaggctgctgaagatttattgtcacaaattcaggaaaattaccagaagccgctg
gaagaattggaggtattgaaagaagcagcaagccacgtcctttcaaagcacaacaatgaa
ctaaaggcggctgaggcgctcgtgagggaagctgaggcaaagatgcaggaaagcaaccac
ctgctgctcatggtcaatgctaatctgagagaattcagtgataaaaagctgcatgttcaa
gaagaacaaaatctgacctcagagctcattgtccaaggaagaggattgatagatgctgct
gctgcacaaacagatgctgtacaagatgctctagagcacttagaggatcaccaggataag
ctacttttatggtctgccaaaatcaggcaccacatagatgacctggtcatgcacatgtcc
caaaggaacgcagtcgacctggtctacagagctgaggaccatgccgctgagttccagaga
ctagcagatgttctgtacagtggccttgaaaacatcagaaatgtgtccctgaatgccacc
agtgcagcctatgtccattacaacatccagagcctgattgaagaatcggaggaactggcc
agagatgctcacaggactgtgactgagacgagcctgctctcagaatcccttgtttctaac
gggaaagcggccgtgcagcgcagctccagatttctaaaagaaggcaacaacctcagcagg
aagcttccaggtattgcattggaactgagtgaattgagaaataagacaaacagatttcaa
gagaatgctgttgaaattaccaggcaaaccaatgaatcactcttgatacttagagcaatt
cctaaaggtataagagacaagggagccaaaaccaaagagctggccacgtctgcaagccag
agcgcggtgagcacgctgagggacgtggcggggctgagccaggagctgctgaacacatct
gccagcctgtccagggtcaacaccacattacgagagacacaccagcttctgcaggactcc
accatggccactctgttggctggaagaaaagtcaaagacgtggaaattcaagccaacctt
ttgtttgatcggttgaagcctttgaagatgttagaggagaatctgagcagaaacctatca
gaaattaaactgttgatcagccaggcccgcaaacaagcagcttctattaaagtcgccgtg
tctgcagacagagattgcatccgggcctaccagcctcagatttcctctaccaactacaat
accttaacactaaatgttaagacacaggaacccgataatcttctcttctacctcggtagc
agcaccgcttctgatttccttgcagtggagatgcggcgagggagagtggccttcctgtgg
gacctgggctccgggtccacacgcttggagtttccagactttcccattgatgacaacaga
tggcacagtatccatgtagccagatttggaaacattggttcactgagtgtaaaggaaatg
agctcaaatcaaaagtcaccaacaaaaacaagtaaatcccctgggacagctaatgttctg
gatgtaaacaattcaacactcatgtttgttggaggtcttggaggacaaatcaagaaatct
cctgctgtgaaggttactcattttaaaggctgcttgggggaggccttcctgaatggaaaa
tccataggcctatggaactatattgaaagggaaggcaagtgccgtgggtgcttcggaagc
tcccagaatgaagacccttccttccattttgacgggagtgggtactctgtcgtggagaag
tcacttccggctaccgtgacccagataatcatgctttttaataccttttcacctaatgga
cttcttctctacctgggttcatacggcacaaaagactttttatccatcgagctgtttcgt
ggcagagtgaaggttatgactgacctgggttcaggacccattacccttttgacagacaga
cgttataacaatggaacctggtacaaaattgccttccagcgaaaccggaagcaaggagtg
ctagcagttatcgatgcctataacaccagtaataaagaaaccaagcagggcgagactccg
ggagcatcttctgacctcaaccgcctagacaaggacccgatttatgtgggtggattacca
aggtcaagagttgtaaggagaggtgtcaccaccaaaagctttgtgggctgcatcaagaac
ctggaaatatccagatcaacctttgacttactcagaaattcctatggagtgagaaaaggc
tgtttactggagcccatccggagtgttagcttcctgaaaggcggctacattgaattgcca
cccaaatctttgtcaccagaatcagaatggctggtaacatttgccaccacgaacagcagt
ggcatcatcctggctgccctcggcggggatgtggagaagcggggtgatcgtgaggaagca
cacgtgcccttcttttccgtcatgctgatcggaggcaacattgaggtacatgtcaatcct
ggggatgggacaggcctgagaaaagctctcctgcacgctcccacgggtacctgcagtgat
ggacaagcgcattccatctccttggtcaggaatcggagaattatcactgtccaattggat
gagaacaatcctgtggaaatgaagttgggcacattagtagaaagcaggacgataaatgtg
tccaatctgtacgtcgggggaattccagagggagaggggacgtcactgctcacaatgaga
agatcgttccatggctgtatcaaaaacctgatcttcaatttggaacttttggatttcaac
agtgcagttggccatgagcaagtcgacctggacacctgctggctgtcagaaaggcctaag
ctggctcccgatgcagaggacagcaagctcttgccagagccccgggcttttccagaacag
tgtgtggtggatgcagctctggagtacgttcccggcgctcaccagtttggtctcacacaa
aacagccatttcatcttgccttttaatcagtcggctgtcagaaagaagctctcggttgag
ctaagcatccgcacgttcgcctccagcggcctgatttactacatggctcatcagaaccaa
gcagactacgctgtgctccagctgcacgggggccgcctccacttcatgtttgaccttggc
aaaggcagaacaaaggtctctcaccctgcactgctcagtgatggcaagtggcacacggtc
aagacagactatgttaaaagaaaaggcttcataactgtcgacggccgagagtctcccatg
gtgactgtggtgggagatggaaccatgctggatgtggagggtttgttctacctaggaggc
ctgccctcccagtaccaggccaggaaaattggaaatatcacccacagcatccctgcctgc
attggggatgtgacggttaacagcaaacagctggacaaggacagcccggtgtctgccttc
acggtgaacaggtgctacgcagtggcccaggaaggaacatactttgacggaagcggatat
gcagctcttgtcaaagagggctacaaagtccagtcagatgtgaacatcacactggagttt
cgaacctcctcgcagaatggcgtcctcctggggatcagcactgccaaagtggatgccatt
ggactagagcttgtggacggcaaggtcttgttccatgtcaacaatggtgctggcaggata
acagctgcatatgagcccaaaaccgccactgtgctctgtgatggaaaatggcacactctt
caagctaacaaaagcaaacaccgtatcactctgattgttgacgggaacgcagttggcgct
gaaagtccacacacccagtctacctcagtggacaccaacaatcccatttatgttggtggc
tatcctgctggtgtgaagcaaaaatgcctgcgcagccagacctcgttccgcgggtgtttg
aggaagctagctctgattaagagcccgcaggtgcagtcctttgacttcagcagagcgttc
gaactgcacggagttttccttcattcctgtcctgggaccgagtcctga

Protein Sequence

>284217 : length: 3075
MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRP
VRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVA
YVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEV
ICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMT
LSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES
CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGV
CINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN
GKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGK
ACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIP
SQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV
DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLM
TVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSC
ESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEP
SRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPT
VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR
ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVS
DGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHT
QGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLG
YRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALR
ADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPD
FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLI
KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYI
LIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGY
HRGKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYG
KVTGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQ
TPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDEC
VGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLE
GVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQT
LDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPL
EELEVLKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQ
EEQNLTSELIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMS
QRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELA
RDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQ
ENAVEITRQTNESLLILRAIPKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTS
ASLSRVNTTLRETHQLLQDSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLS
EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGS
STASDFLAVEMRRGRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEM
SSNQKSPTKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGK
SIGLWNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNG
LLLYLGSYGTKDFLSIELFRGRVKVMTDLGSGPITLLTDRRYNNGTWYKIAFQRNRKQGV
LAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVGCIKN
LEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATTNSS
GIILAALGGDVEKRGDREEAHVPFFSVMLIGGNIEVHVNPGDGTGLRKALLHAPTGTCSD
GQAHSISLVRNRRIITVQLDENNPVEMKLGTLVESRTINVSNLYVGGIPEGEGTSLLTMR
RSFHGCIKNLIFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQ
CVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMAHQNQ
ADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGFITVDGRESPM
VTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQLDKDSPVSAF
TVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAI
GLELVDGKVLFHVNNGAGRITAAYEPKTATVLCDGKWHTLQANKSKHRITLIVDGNAVGA
ESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQVQSFDFSRAF
ELHGVFLHSCPGTES



')