Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2745

Name

GLRX

Synonym

GRX|GRX1;glutaredoxin (thioltransferase);GLRX;glutaredoxin (thioltransferase)

Definition

TTase-1|glutaredoxin-1|thioltransferase-1

Position

5q14

Gene Type

protein-coding

Pathways and Diseases

Pathway

Metabolism of nucleotides;Reactome;REACT:1698

Pathway

ascorbate recycling (cytosolic);BioCyc;PWY-6370

Pathway

glutathione redox reactions II;BioCyc;GLUT-REDOX-PWY

Pathway

Synthesis and interconversion of nucleotide di- and triphosphates;PID Reactome;500233

Pathway

arsenate detoxification I (glutaredoxin);BioCyc;PWY-4202

Disease

Embryoma;FunDO

Disease

Cancer;FunDO

Disease

cognitive trait;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to Entrez Gene

2745

Links to all GeneRIF Items

2745

Links to iHOP

2745

Sequence Information

Nucleotide Sequence

>2745 : length: 321
atggctcaagagtttgtgaactgcaaaatccagcctgggaaggtggttgtgttcatcaag
cccacctgcccgtactgcaggagggcccaagagatcctcagtcaattgcccatcaaacaa
gggcttctggaatttgtcgatatcacagccaccaaccacactaacgagattcaagattat
ttgcaacagctcacgggagcaagaacggtgcctcgagtctttattggtaaagattgtata
ggcggatgcagtgatctagtctctttgcaacagagtggggaactgctgacgcggctaaag
cagattggagctctgcagtaa

Protein Sequence

>2745 : length: 106
MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDY
LQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ



')