Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

269

Name

AMHR2

Synonym

AMHR|MISR2|MISRII|MRII;anti-Mullerian hormone receptor, type II;AMHR2;anti-Mullerian hormone receptor, type II

Definition

AMH type II receptor|MIS type II receptor|Mullerian inhibiting substance type II receptor|anti-Muellerian hormone type II receptor|anti-Muellerian hormone type-2 receptor

Position

12q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

ALK2 signaling events;PID Curated;200138

Disease

Persistent Mullerian duct syndrome, type II;OMIM

Disease

estradiol;GAD

Disease

Ovarian disease;FunDO

Disease

Female reproductive cancer;FunDO

Disease

REPRODUCTION;GAD

Disease

Multiple endocrine neoplasia;FunDO

External Links

Links to Entrez Gene

269

Links to all GeneRIF Items

269

Links to iHOP

269

Sequence Information

Nucleotide Sequence

>269 : length: 1437
atgctagggtctttggggctttgggcattacttcccacagctgtggaagcacccccaaac
aggcgaacctgtgtgttctttgaggcccctggagtgcggggaagcacaaagacactggga
gagctgctagatacaggcacagagctccccagagctatccgctgcctctacagccgctgc
tgctttgggatctggaacctgacccaagaccgggcacaggtggaaatgcaaggatgccga
gacagtgatgagccaggctgtgagtccctccactgtgacccaagtccccgagcccacccc
agccctggctccactctcttcacctgctcctgtggcactgacttctgcaatgccaattac
agccatctgcctcctccagggagccctgggactcctggctcccagggtccccaggctgcc
ccaggtgagtccatctggatggcactggtgctgctggggctgttcctcctcctcctgctg
ctgctgggcagcatcatcttggccctgctacagcgaaagaactacagagtgcgaggtgag
ccagtgccagagccaaggccagactcaggcagggactggagtgtggagctgcaggagctg
cctgagctgtgtttctcccaggtaatccgggaaggaggtcatgcagtggtttgggccggg
cagctgcaaggaaaactggttgccatcaaggccttcccaccgaggtctgtggctcagttc
caagctgagagagcattgtacgaacttccaggcctacagcacgaccacattgtccgattt
atcactgccagccgggggggtcctggccgcctgctctctgggcccctgctggtactggaa
ctgcatcccaagggctccctgtgccactacttgacccagtacaccagtgactggggaagt
tccctgcggatggcactgtccctggcccagggcctggcatttctccatgaggagcgctgg
cagaatggccaatataaaccaggtattgcccaccgagatctgagcagccagaatgtgctc
attcgggaagatggatcgtgtgccattggagacctgggccttgccttggtgctccctggc
ctcactcagccccctgcctggacccctactcaaccacaaggcccagctgccatcatggaa
gctggcacccagaggtacatggcaccagagctcttggacaagactctggacctacaggat
tggggcatggccctccgacgagctgatatttactctttggctctgctcctgtgggagata
ctgagccgctgcccagatttgaggcctgcagtccaccacccttccaactggcctatgagg
cagaactgggcaatacccctacctctgatgagctatgggccttggcagtgcaggagagga
ggcgtccctacatcccatccacctggcgctgctttgccacagaccctgatgggctga

Protein Sequence

>269 : length: 478
MLGSLGLWALLPTAVEAPPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRC
CFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANY
SHLPPPGSPGTPGSQGPQAAPGESIWMALVLLGLFLLLLLLLGSIILALLQRKNYRVRGE
PVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKLVAIKAFPPRSVAQF
QAERALYELPGLQHDHIVRFITASRGGPGRLLSGPLLVLELHPKGSLCHYLTQYTSDWGS
SLRMALSLAQGLAFLHEERWQNGQYKPGIAHRDLSSQNVLIREDGSCAIGDLGLALVLPG
LTQPPAWTPTQPQGPAAIMEAGTQRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWEI
LSRCPDLRPAVHHPSNWPMRQNWAIPLPLMSYGPWQCRRGGVPTSHPPGAALPQTLMG



')