Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

26585

Name

GREM1

Synonym

CKTSF1B1|DAND2|DRM|GREMLIN|IHG-2;gremlin 1;GREM1;gremlin 1

Definition

DAN domain family member 2|cell proliferation-inducing gene 2 protein|cysteine knot superfamily 1, BMP antagonist 1|down-regulated in Mos-transformed cells protein|gremlin 1, cysteine knot superfamily, homolog|gremlin 1-like protein|gremlin-1|increased in

Position

15q13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

BMP receptor signaling;PID Curated;200123

Disease

Embryoma;FunDO

Disease

Diabetes mellitus;FunDO

Disease

nonsyndromic cleft lip with or without cleft palate;GAD

Disease

Basal cell carcinoma;FunDO

Disease

Kidney disease;FunDO

Disease

DEVELOPMENTAL;GAD

Disease

Hypertension, Pulmonary;FunDO

External Links

Links to Entrez Gene

26585

Links to all GeneRIF Items

26585

Links to iHOP

26585

Sequence Information

Nucleotide Sequence

>26585 : length: 345
atgagccgcacagcctacacggtgggagccctgcatgtgacggagcgcaaatacctgaag
cgagactggtgcaaaacccagccgcttaagcagaccatccacgaggaaggctgcaacagt
cgcaccatcatcaaccgcttctgttacggccagtgcaactctttctacatccccaggcac
atccggaaggaggaaggttcctttcagtcctgctccttctgcaagcccaagaaattcact
accatgatggtcacactcaactgccctgaactacagccacctaccaagaagaagagagtc
acacgtgtgaagcagtgtcgttgcatatccatcgatttggattaa

Protein Sequence

>26585 : length: 114
MSRTAYTVGALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRH
IRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD



')