Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2625

Name

GATA3

Synonym

HDR|HDRS;GATA binding protein 3;GATA3;GATA binding protein 3

Definition

GATA-binding factor 3|trans-acting T-cell-specific transcription factor GATA-3

Position

10p15

Gene Type

protein-coding

Pathways and Diseases

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

gata3 participate in activating the th2 cytokine genes expression;PID BioCarta;100157

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

C-MYB transcription factor network;PID Curated;200130

Disease

Autoimmune disease;FunDO

Disease

Lupus erythematosus;FunDO

Disease

Dermatitis;FunDO

Disease

Hypoparathyroidism, sensorineural deafness, and renal dysplasia;OMIM

Disease

IMMUNE;GAD

Disease

Lymphoma;FunDO

Disease

Atopic rhinitis;FunDO

Disease

Asthma;FunDO

Disease

Aplastic anemia;FunDO

Disease

Asthma;GAD

Disease

Deafness;FunDO

Disease

Pancreas cancer;FunDO

Disease

Breast cancer;FunDO

Disease

Stomach cancer;FunDO

Disease

Cervical cancer;FunDO

External Links

Links to Entrez Gene

2625

Links to all GeneRIF Items

2625

Links to iHOP

2625

Sequence Information

Nucleotide Sequence

>2625 : length: 1335
atggaggtgacggcggaccagccgcgctgggtgagccaccaccaccccgccgtgctcaac
gggcagcacccggacacgcaccacccgggcctcagccactcctacatggacgcggcgcag
tacccgctgccggaggaggtggatgtgctttttaacatcgacggtcaaggcaaccacgtc
ccgccctactacggaaactcggtcagggccacggtgcagaggtaccctccgacccaccac
gggagccaggtgtgccgcccgcctctgcttcatggatccctaccctggctggacggcggc
aaagccctgggcagccaccacaccgcctccccctggaatctcagccccttctccaagacg
tccatccaccacggctccccggggcccctctccgtctaccccccggcctcgtcctcctcc
ttgtcggggggccacgccagcccgcacctcttcaccttcccgcccaccccgccgaaggac
gtctccccggacccatcgctgtccaccccaggctcggccggctcggcccggcaggacgag
aaagagtgcctcaagtaccaggtgcccctgcccgacagcatgaagctggagtcgtcccac
tcccgtggcagcatgaccgccctgggtggagcctcctcgtcgacccaccaccccatcacc
acctacccgccctacgtgcccgagtacagctccggactcttcccccccagcagcctgctg
ggcggctcccccaccggcttcggatgcaagtccaggcccaaggcccggtccagcacagaa
ggcagggagtgtgtgaactgtggggcaacctcgaccccactgtggcggcgagatggcacg
ggacactacctgtgcaacgcctgcgggctctatcacaaaatgaacggacagaaccggccc
ctcattaagcccaagcgaaggctgtctgcagccaggagagcagggacgtcctgtgcgaac
tgtcagaccaccacaaccacactctggaggaggaatgccaatggggaccctgtctgcaat
gcctgtgggctctactacaagcttcacaatattaacagacccctgactatgaagaaggaa
ggcatccagaccagaaaccgaaaaatgtctagcaaatccaaaaagtgcaaaaaagtgcat
gactcactggaggacttccccaagaacagctcgtttaacccggccgccctctccagacac
atgtcctccctgagccacatctcgcccttcagccactccagccacatgctgaccacgccc
acgccgatgcacccgccatccagcctgtcctttggaccacaccacccctccagcatggtc
accgccatgggttag

Protein Sequence

>2625 : length: 444
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG



')