Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

25937

Name

WWTR1

Synonym

TAZ;WW domain containing transcription regulator 1;WWTR1;WW domain containing transcription regulator 1

Definition

WW domain-containing transcription regulator protein 1|transcriptional co-activator with PDZ-binding motif|transcriptional coactivator with PDZ-binding motif

Position

3q23-q24

Gene Type

protein-coding

External Links

Links to Entrez Gene

25937

Links to all GeneRIF Items

25937

Links to iHOP

25937

Sequence Information

Nucleotide Sequence

>25937 : length: 1203
atgaatccggcctcggcgccccctccgctcccgccgcctgggcagcaagtgatccacgtc
acgcaggacctagacacagacctcgaagccctcttcaactctgtcatgaatccgaagcct
agctcgtggcggaagaagatcctgccggagtctttctttaaggagcctgattcgggctcg
cactcgcgccagtccagcaccgactcgtcgggcggccacccggggcctcgactggctggg
ggtgcccagcatgtccgctcgcactcgtcgcccgcgtccctgcagctgggcaccggcgcg
ggtgctgcgggtagccccgcgcagcagcacgcgcacctccgccagcagtcctacgacgtg
accgacgagctgccactgcccccgggctgggagatgaccttcacggccactggccagagg
tacttcctcaatcacatagaaaaaatcaccacatggcaagaccctaggaaggcgatgaat
cagcctctgaatcatatgaacctccaccctgccgtcagttccacaccagtgcctcagagg
tccatggcagtatcccagccaaatctcgtgatgaatcaccaacaccagcagcagatggcc
cccagtaccctgagccagcagaaccaccccactcagaacccacccgcagggctcatgagt
atgcccaatgcgctgaccactcagcagcagcagcagcagaaactgcggcttcagagaatc
cagatggagagagaaaggattcgaatgcgccaagaggagctcatgaggcaggaagctgcc
ctctgtcgacagctccccatggaagctgagactcttgccccagttcaggctgctgtcaac
ccacccacgatgaccccagacatgagatccatcactaataatagctcagatcctttcctc
aatggagggccatatcattcgagggagcagagcactgacagtggcctggggttagggtgc
tacagtgtccccacaactccggaggacttcctcagcaatgtggatgagatggatacagga
gaaaacgcaggacaaacacccatgaacatcaatccccaacagacccgtttccctgatttc
cttgactgtcttccaggaacaaacgttgacttaggaactttggaatctgaagacctgatc
cccctcttcaatgatgtagagtctgctctgaacaaaagtgagccctttctaacctggctg
taa

Protein Sequence

>25937 : length: 400
MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQR
SMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL
NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL



')