Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

25875

Name

LETMD1

Synonym

1110019O13Rik|HCCR-1|HCCR-2|HCCR1|HCRR-2;LETM1 domain containing 1;LETMD1;LETM1 domain containing 1

Definition

LETM1 domain-containing protein 1|cervical cancer 1 proto-oncogene protein p40|cervical cancer proto-oncogene 2 protein|regulator of TP53

Position

12q13.12

Gene Type

protein-coding

External Links

Links to Entrez Gene

25875

Links to all GeneRIF Items

25875

Links to iHOP

25875

Sequence Information

Nucleotide Sequence

>25875 : length: 915
atgtcttatgtggtaaccaagacaaaagcgattaatgggaaataccatcgtttcttgggt
cgtcatttcccccgcttctatgtcctgtacacaatcttcatgaaaggattgcagatgtta
tgggctgatgccaaaaaggctagaagaataaagacaaatatgtggaagcacaatataaag
tttcatcaacttccataccgggagatggagcatttgagacagttccgccaagacgtcacc
aagtgtcttttcctaggtattatttccattccaccttttgccaactacctggtcttcttg
ctaatgtacctgtttcccaggcaactactgatcaggcatttctggaccccaaaacaacaa
actgatttcttagatatctatcatgctttccggaagcagtcccacccagaaattattagt
tatttagaaaaggtcatccctctcatttctgatgcaggactccggtggcgtctgacagat
ctgtgcaccaagatacagcgtggtacccacccagcaatacatgatatcttggctctgaga
gagtgtttctctaaccatcctctgggcatgaaccaactccaggctttgcacgtgaaagcc
ttgagccgggccatgcttctcacatcttacctgcctcctcccttgttgagacatcgtttg
aagactcatacaactgtgattcaccaactggacaaggctttggcaaagctggggattggc
cagctgactgctcaggaagtaaaatcggcttgttatctccgtggcctgaattctacgcat
attggtgaagataggtgtcgaacttggctgggagaatggctgcagatttcctgcagcctg
aaagaagctgagctgtctctcttgctgcacaacgtggtcctgctctccaccaactacctt
gggacaaggcgctga

Protein Sequence

>25875 : length: 304
MSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIK
FHQLPYREMEHLRQFRQDVTKCLFLGIISIPPFANYLVFLLMYLFPRQLLIRHFWTPKQQ
TDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALR
ECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIG
QLTAQEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVLLSTNYL
GTRR



')