Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

25800

Name

SLC39A6

Synonym

LIV-1;solute carrier family 39 (zinc transporter), member 6;SLC39A6;solute carrier family 39 (zinc transporter), member 6

Definition

LIV-1 protein, estrogen regulated|ZIP-6|estrogen-regulated protein LIV-1|solute carrier family 39 (metal ion transporter), member 6|solute carrier family 39 member 6|zinc transporter ZIP6|zrt- and Irt-like protein 6

Position

18q12.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Transmembrane transport of small molecules;Reactome;REACT:15518

External Links

Links to Entrez Gene

25800

Links to all GeneRIF Items

25800

Links to iHOP

25800

Sequence Information

Nucleotide Sequence

>25800 : length: 1302
atgggcatccaggttccgctgaatgcaacagagttcaactatctctgtccagccatcatc
aaccaaattgatgctagatcttgtctgattcatacaagtgaaaagaaggctgaaatccct
ccaaagacctattcattacaaatagcctgggttggtggttttatagccatttccatcatc
agtttcctgtctctgctgggggttatcttagtgcctctcatgaatcgggtgtttttcaaa
tttctcctgagtttccttgtggcactggccgttgggactttgagtggtgatgctttttta
caccttcttccacattctcatgcaagtcaccaccatagtcatagccatgaagaaccagca
atggaaatgaaaagaggaccacttttcagtcatctgtcttctcaaaacatagaagaaagt
gcctattttgattccacgtggaagggtctaacagctctaggaggcctgtatttcatgttt
cttgttgaacatgtcctcacattgatcaaacaatttaaagataagaagaaaaagaatcag
aagaaacctgaaaatgatgatgatgtggagattaagaagcagttgtccaagtatgaatct
caactttcaacaaatgaggagaaagtagatacagatgatcgaactgaaggctatttacga
gcagactcacaagagccctcccactttgattctcagcagcctgcagtcttggaagaagaa
gaggtcatgatagctcatgctcatccacaggaagtctacaatgaatatgtacccagaggg
tgcaagaataaatgccattcacatttccacgatacactcggccagtcagacgatctcatt
caccaccatcatgactaccatcatattctccatcatcaccaccaccaaaaccaccatcct
cacagtcacagccagcgctactctcgggaggagctgaaagatgccggcgtcgccactctg
gcctggatggtgataatgggtgatggcctgcacaatttcagcgatggcctagcaattggt
gctgcttttactgaaggcttatcaagtggtttaagtacttctgttgctgtgttctgtcat
gagttgcctcatgaattaggtgactttgctgttctactaaaggctggcatgaccgttaag
caggctgtcctttataatgcattgtcagccatgctggcgtatcttggaatggcaacagga
attttcattggtcattatgctgaaaatgtttctatgtggatatttgcacttactgctggc
ttattcatgtatgttgctctggttgatatggtaagtttttaa

Protein Sequence

>25800 : length: 433
MGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISII
SFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPA
MEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQ
KKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEE
EVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHP
HSHSQRYSREELKDAGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCH
ELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAG
LFMYVALVDMVSF



')