Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

25794

Name

FSCN2

Synonym

RFSN|RP30;fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotus purpuratus);FSCN2;fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotus purpuratus)

Definition

fascin-2

Position

17q25

Gene Type

protein-coding

External Links

Links to Entrez Gene

25794

Links to all GeneRIF Items

25794

Links to iHOP

25794

Sequence Information

Nucleotide Sequence

>25794 : length: 1551
atgccgacgaacggcctgcaccaggtgctgaagatccagtttggcctcgtcaacgacact
gaccgctacctgacagctgagagcttcggcttcaaggtcaatgcctcggcacccagcctc
aagaggaagcagacctgggtgctggaacccgacccaggacaaggcacggctgtgctgctc
cgcagcagccacctgggccgctacctgtcggcagaagaggacgggcgcgtggcctgtgag
gcagagcagccgggccgtgactgccgcttcctggtcctgccgcagccagatgggcgctgg
gtgctgcggtccgagccgcacggccgcttcttcggaggcaccgaggaccagctgtcctgc
ttcgccacagccgtttccccggccgagctgtggaccgtgcacctggccatccacccgcag
gcccacctgctgagcgtgagccggcggcgctacgtgcacctgtgcccgcgggaggacgag
atggccgcagacggagacaagccctggggcgtggacgccctcctcaccctcatcttccgg
agccgacggtactgcctcaagtcctgtgacagccgctacctgcgcagcgacggccgtctg
gtctgggagcctgagccccgtgcctgctacacgctggagttcaaggcgggcaagctggcc
ttcaaggactgcgacggccactacctggcacccgtggggcccgcaggcaccctcaaggcc
ggccgaaacacgcgacctggcaaggatgagctctttgatctggaggagagtcacccacag
gtggtgctggtggctgccaaccaccgctacgtctctgtgcggcaaggggtcaacgtctca
gccaatcaggatgatgaactagaccacgagaccttcctgatgcaaattgaccaggagaca
aagaagtgcaccttctattccagcactgggggctactggaccctggtcacccatgggggc
attcacgccacagccacacaagtttctgccaacaccatgtttgagatggagtggcgtggc
cggcgggtagcactcaaagccagcaacgggcgctacgtgtgcatgaagaagaatgggcag
ctggcggctatcagcgattttgtcgggcccccaccccgcccggcctggacagggaaggtg
gcgggaggggcagcgcagcagacgctctccccgccaggcaaggacgaagagttcaccctc
aagctcatcaaccggcccatcctggtgctgcgcggcctggacggcttcgtctgccaccac
cgcggctccaaccagctggacaccaaccgctccgtctacgacgtcttccacctgagcttc
agcgacggcgcctaccggatccgaggccgcgacggagggttctggtacacgggcagccac
ggcagcgtgtgcagcgacggcgaacgcgccgaggacttcgtcttcgagttccgtgagcgc
ggccgcctggccatccgcgcccggagcggcaagtacctgcgcggcggcgcctcgggcctg
ctgcgggccgatgccgacgccccggccgggaccgcgctttgggagtactga

Protein Sequence

>25794 : length: 516
MPTNGLHQVLKIQFGLVNDTDRYLTAESFGFKVNASAPSLKRKQTWVLEPDPGQGTAVLL
RSSHLGRYLSAEEDGRVACEAEQPGRDCRFLVLPQPDGRWVLRSEPHGRFFGGTEDQLSC
FATAVSPAELWTVHLAIHPQAHLLSVSRRRYVHLCPREDEMAADGDKPWGVDALLTLIFR
SRRYCLKSCDSRYLRSDGRLVWEPEPRACYTLEFKAGKLAFKDCDGHYLAPVGPAGTLKA
GRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQDDELDHETFLMQIDQET
KKCTFYSSTGGYWTLVTHGGIHATATQVSANTMFEMEWRGRRVALKASNGRYVCMKKNGQ
LAAISDFVGPPPRPAWTGKVAGGAAQQTLSPPGKDEEFTLKLINRPILVLRGLDGFVCHH
RGSNQLDTNRSVYDVFHLSFSDGAYRIRGRDGGFWYTGSHGSVCSDGERAEDFVFEFRER
GRLAIRARSGKYLRGGASGLLRADADAPAGTALWEY



')