Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2475

Name

MTOR

Synonym

FRAP|FRAP1|FRAP2|RAFT1|RAPT1;mechanistic target of rapamycin (serine/threonine kinase);MTOR;mechanistic target of rapamycin (serine/threonine kinase)

Definition

FK506 binding protein 12-rapamycin associated protein 1|FK506 binding protein 12-rapamycin associated protein 2|FK506-binding protein 12-rapamycin complex-associated protein 1|FKBP-rapamycin associated protein|FKBP12-rapamycin complex-associated protein 1

Position

1p36.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

Release of eIF4E;PID Reactome;500965

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

LKB1 signaling events;PID Curated;200061

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

mtor signaling pathway;PID BioCarta;100101

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

EGFR-dependent Endothelin signaling events;PID Curated;200095

Pathway

stat3 signaling pathway;PID BioCarta;100028

Pathway

CXCR3-mediated signaling events;PID Curated;200150

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Hypoxia response via HIF activation;PANTHER;P00030

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

mTORC1-mediated signalling;PID Reactome;500980

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

b cell survival pathway;PID BioCarta;100228

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Pathway

mTOR signalling;PID Reactome;500865

Pathway

S6K1-mediated signalling;PID Reactome;500921

Pathway

regulation of eif-4e and p70s6 kinase;PID BioCarta;100178

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

External Links

Links to Entrez Gene

2475

Links to all GeneRIF Items

2475

Links to iHOP

2475

Sequence Information

Nucleotide Sequence

>2475 : length: 7650
atgcttggaaccggacctgccgccgccaccaccgctgccaccacatctagcaatgtgagc
gtcctgcagcagtttgccagtggcctaaagagccggaatgaggaaaccagggccaaagcc
gccaaggagctccagcactatgtcaccatggaactccgagagatgagtcaagaggagtct
actcgcttctatgaccaactgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagctagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccattggccgtcttgccatggcaggggacactttt
accgctgagtacgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacatgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcaacccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgtagccgcccttcgtgcctgtctgattctcaca
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaagggatttgatgagaccttggccaaagagaagggcatgaatcgggatgatcgg
atccatggagccttgttgatccttaacgagctggtccgaatcagcagcatggagggagag
cgtctgagagaagaaatggaagaaatcacacagcagcagctggtacacgacaagtactgc
aaagatctcatgggcttcggaacaaaacctcgtcacattacccccttcaccagtttccag
gctgtacagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttgggacctcccccagtccagctaagtccaccctggtggagagccgg
tgttgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcattccgaccttctgccttcacagatacccagtatctccaagataccatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcggccttccaagccctggggctactt
tctgtggctgtgaggtctgagtttaaggtctatttgcctcgcgtgctggacatcatccga
gcggccctgcccccaaaggacttcgcccataagaggcagaaggcaatgcaggtggatgcc
acagtcttcacttgcatcagcatgctggctcgagcaatggggccaggcatccagcaggat
atcaaggagctgctggagcccatgctggcagtgggactaagccctgccctcactgcagtg
ctctacgacctgagccgtcagattccacagctaaagaaggacattcaagatgggctactg
aaaatgctgtccctggtccttatgcacaaaccccttcgccacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacgaccctccctgaggccagcgatgtgggc
agcatcactcttgccctccgaacgcttggcagctttgaatttgaaggccactctctgacc
caatttgttcgccactgtgcggatcatttcctgaacagtgagcacaaggagatccgcatg
gaggctgcccgcacctgctcccgcctgctcacaccctccatccacctcatcagtggccat
gctcatgtggttagccagaccgcagtgcaagtggtggcagatgtgcttagcaaactgctc
gtagttgggataacagatcctgaccctgacattcgctactgtgtcttggcgtccctggac
gagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgtttgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccgactcagtagc
atgaaccctgcctttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ttggagcacagtgggattggaagaatcaaagagcagagtgcccgcatgctggggcacctg
gtctccaatgccccccgactcatccgcccctacatggagcctattctgaaggcattaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcctggca
acaataggagaattggcacaggttagtggcctggaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaggattcctctttgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtagtagagccctacaggaag
taccctactttgcttgaggtgctactgaattttctgaagactgagcagaaccagggtaca
cgcagagaggccatccgtgtgttagggcttttaggggctttggatccttacaagcacaaa
gtgaacattggcatgatagaccagtcccgggatgcctctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactatagcactagtgaaatgctggtcaacatgggaaac
ttgcctctggatgagttctacccagctgtgtccatggtggccctgatgcggatcttccga
gaccagtcactctctcatcatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggactcaaatgtgtgcagttcctgccccaggtcatgcccacgttccttaacgtc
attcgagtctgtgatggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcaattcagagcacgatcattcttctcattgagcaaattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctgcgt
gtcttcatgcatgacaacagcccaggccgcattgtctctatcaagttactggctgcaatc
cagctgtttggcgccaacctggatgactacctgcatttactgctgcctcctattgttaag
ttgtttgatgcccctgaagctccactgccatctcgaaaggcagcgctagagactgtggac
cgcctgacggagtccctggatttcactgactatgcctcccggatcattcaccctattgtt
cgaacactggaccagagcccagaactgcgctccacagccatggacacgctgtcttcactt
gtttttcagctggggaagaagtaccaaattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaatcatcagcgctatgatgtgctcatctgcagaattgtcaagggatac
acacttgctgatgaagaggaggatcctttgatttaccagcatcggatgcttaggagtggc
caaggggatgcattggctagtggaccagtggaaacaggacccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcctggggcgctgccaggagggtctccaaagatgactgg
ctggaatggctgagacggctgagcctggagctgctgaaggactcatcatcgccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctcttcaatgct
gcatttgtgtcctgctggtctgaactgaatgaagatcaacaggatgagctcatcagaagc
atcgagttggccctcacctcacaagacatcgctgaagtcacacagaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccactgagagatgacaatggcatt
gttctgctgggtgagagagctgccaagtgccgagcatatgccaaagcactacactacaaa
gaactggagttccagaaaggccccacccctgccattctagaatctctcatcagcattaat
aataagctacagcagccggaggcagcggccggagtgttagaatatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcacgagtgggaggatgccctt
gtggcctatgacaagaaaatggacaccaacaaggacgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatggggtcaactccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgggacacc
catgatggggcattttatagagctgtgctggcactgcatcaggacctcttctccttggca
caacagtgcattgacaaggccagggacctgctggatgctgaattaactgcgatggcagga
gagagttacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtatcgtagaggactggcagaaaatccttatggtgcgg
tcccttgtggtcagccctcatgaagacatgagaacctggctcaagtatgcaagcctgtgc
ggcaagagtggcaggctggctcttgctcataaaactttagtgttgctcctgggagttgat
ccgtctcggcaacttgaccatcctctgccaacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagtgcccgcaagatcgatgccttccagcacatgcagcatttt
gtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccagcagcataag
caggaactgcacaagctcatggcccgatgcttcctgaaacttggagagtggcagctgaat
ctacagggcatcaatgagagcacaatccccaaagtgctgcagtactacagcgccgccaca
gagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaacttcgaagct
gtgctacactacaaacatcagaaccaagcccgcgatgagaagaagaaactgcgtcatgcc
agcggggccaacatcaccaacgccaccactgccgccaccacggccgccactgccaccacc
actgccagcaccgagggcagcaacagtgagagcgaggccgagagcaccgagaacagcccc
accccatcgccgctgcagaagaaggtcactgaggatctgtccaaaaccctcctgatgtac
acggtgcctgccgtccagggcttcttccgttccatctccttgtcacgaggcaacaacctc
caggatacactcagagttctcaccttatggtttgattatggtcactggccagatgtcaat
gaggccttagtggagggggtgaaagccatccagattgatacctggctacaggttatacct
cagctcattgcaagaattgatacgcccagacccttggtgggacgtctcattcaccagctt
ctcacagacattggtcggtaccacccccaggccctcatctacccactgacagtggcttct
aagtctaccacgacagcccggcacaatgcagccaacaagattctgaagaacatgtgtgag
cacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgagtggcc
atcctctggcatgagatgtggcatgaaggcctggaagaggcatctcgtttgtactttggg
gaaaggaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaacgg
ggcccccagactctgaaggaaacatcctttaatcaggcctatggtcgagatttaatggag
gcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaagcc
tgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcagctcacatcc
ttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagcaccgtctttg
caagtcatcacatccaagcagaggccccggaaattgacacttatgggcagcaacggacat
gagtttgttttccttctaaaaggccatgaagatctgcgccaggatgagcgtgtgatgcag
ctcttcggcctggttaacacccttctggccaatgacccaacatctcttcggaaaaacctc
agcatccagagatacgctgtcatccctttatcgaccaactcgggcctcattggctgggtt
ccccactgtgacacactgcacgccctcatccgggactacagggagaagaagaagatcctt
ctcaacatcgagcatcgcatcatgttgcggatggctccggactatgaccacttgactctg
atgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggggacgacctggcc
aagctgctgtggctgaaaagccccagctccgaggtgtggtttgaccgaagaaccaattat
acccgttctttagcggtcatgtcaatggttgggtatattttaggcctgggagatagacac
ccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgactttggggac
tgctttgaggttgctatgacccgagagaagtttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacaggcctggatggcaactacagaatcacatgc
cacacagtgatggaggtgctgcgagagcacaaggacagtgtcatggccgtgctggaagcc
tttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaag
cgatcccgaacgaggacggattcctactctgctggccagtcagtcgaaattttggacggt
gtggaacttggagagccagcccataagaaaacggggaccacagtgccagaatctattcat
tctttcattggagacggtttggtgaaaccagaggccctaaataagaaagctatccagatt
attaacagggttcgagataagctcactggtcgggacttctctcatgatgacactttggat
gttccaacgcaagttgagctgctcatcaaacaagcgacatcccatgaaaacctctgccag
tgctatattggctggtgccctttctggtaa

Protein Sequence

>2475 : length: 2549
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW



')