Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

23513

Name

SCRIB

Synonym

CRIB1|SCRB1|SCRIB1|Vartul;scribbled homolog (Drosophila);SCRIB;scribbled homolog (Drosophila)

Definition

protein scribble homolog

Position

8q24.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

23513

Links to all GeneRIF Items

23513

Links to iHOP

23513

Sequence Information

Nucleotide Sequence

>23513 : length: 4893
atgctcaagtgcatcccgctgtggcgctgcaaccggcacgtggagtcggtggacaagcgg
cactgttcgctgcaggccgtgccggaggagatctaccgctacagccgcagcctggaggag
ctgctgctcgacgccaaccagctgcgcgagctgcccaagccttttttccggctgctgaac
ttgcgcaagctgggcctgagcgacaacgagatccagcggttgcctcccgaggtggccaac
ttcatgcagctggtggagctggacgtgtcccggaacgatatccctgagatcccggagagc
atcaagttctgcaaggctctggagatcgcggacttcagcgggaaccccctctccaggctc
cctgatggcttcactcagctgcgcagcctggctcacctggccctgaatgatgtgtctctg
caggcactgcccggggacgtgggcaacctcgccaacctggtgaccctggagctccgggag
aacctgctcaagtccctgccagcgtccctgtcatttctggtcaagctggaacagctggat
ctgggaggcaacgatctggaagtgctgccagacactctgggggctctgcccaatcttcgg
gagctgtggcttgaccggaaccagctgtcagcactgcccccggagctcgggaacctgcgg
cgcctggtgtgcctggacgtgtcggaaaaccggctggaggagctgcctgctgagctcggc
gggctggtgctgctcactgacctgctgctgtcccagaacctgctgcggaggctgcccgac
ggcatcggtcagctgaagcagctatccatcctaaaggtagaccagaatcggctgtgcgag
gtgactgaggccatcggggactgtgagaacctctctgagctgatcctcacggagaacctg
ctgatggccctgccccgctccctgggaaagctgactaagctgaccaacctcaacgtggac
cggaaccacctcgaggcgctgccgcccgagatcgggggctgtgtggcactcagcgtcctc
tccttgagggacaaccgcctggccgtcctgccaccagagctggcccacacgacagagctg
cacgtgctggacgtggcggggaaccgcctgcagagtctgccgttcgcgctcacccacctc
aatctcaaggccctgtggctggcagagaaccaggcgcagcccatgctccggttccagacg
gaggatgatgcccggaccggcgagaaggtgctcacctgctacttgctgccccagcagccc
ccactcagcctcgaggatgctgggcagcaggggagcctctcggagacctggagcgatgcc
ccgccgagccgcgtcagcgtcatccagttcctggaggcccccataggtgatgaggacgct
gaggaagctgcagctgagaagcggggcctacagcgccgggccacacctcaccccagcgag
ctcaaggtgatgaagaggagcatcgaggggcggcggagcgaggcctgcccttgccagcca
gactctgggtcgcccttgcctgcagaggaggagaagcggctgagtgccgagtctggcctg
agtgaagactctcgcccatctgccagcacagtctctgaggctgagcccgagggcccgtcg
gctgaggcacagggtgggagccagcaggaagccacgactgctggcggggaggaagacgcc
gaagaggactaccaggagcccacggtgcatttcgcagaggacgcactgctgcccggggat
gacagggagatcgaggaggggcagcctgaggccccctggaccctgccaggcgggaggcag
cggctcatccgcaaggacacacctcactacaaaaagcacttcaagatctccaagctgccc
cagcccgaggccgttgtggctctgctgcagggcatgcagcctgatggggagggccctgtg
gctcccgggggctggcacaatggcccccacgcaccctgggctcctcgggcccagaaggag
gaggaggaggaggaagagggtagtcctcaggaggaggaggaagaggaggaggaggaaaac
agggctgaagaggaagaggccagcactgaggaggaggacaaggagggggccgtggtttct
gcgccctctgtcaagggagtgtcgtttgaccaggccaataacctgctgatagagcctgct
cgcattgaggaggaagagctgaccctcaccatcctgcggcagactgggggcctgggcatc
agcattgcgggcggcaagggctccacaccctataagggggacgacgagggcatattcatc
tctcgggtgtccgaggaaggccctgcggcccgggctggagtccgtgtgggtgacaagctc
ctggaggtgaatggtgtggctctgcagggcgccgagcaccacgaggccgtggaggcgctc
cggggggccggcactgccgtgcagatgcgagtgtggcgggagcgcatggtggagcctgag
aacgcggtcaccatcacgccgctgcggcccgaggatgattacagcccccgagagcggcgg
ggaggggggctgcgcctgcccctgctcccgcctgagagccccgggcccctccgtcagcgc
cacgtggcctgcctggcacgcagcgagagggggctgggcttcagcattgctggtgggaaa
ggctccacaccctacagggctggtgatgcgggcatcttcgtctcccgcattgccgagggc
ggtgctgctcaccgcgcgggcacactgcaggttggcgaccgcgtcctctctattaatgga
gtggacgtgactgaggccaggcatgaccacgccgtctccctgctgaccgctgcctccccc
accatcgccctgctgttggagcgggaggctgggggccctcttcctcccagccctctgcca
cattcctcaccccccaccgctgctgttgccaccaccagcataaccactgccacccccggg
gtgcctgggttgccgagcctggcccccagcctgctggctgccgcgttggaagggccatac
ccagtggaggagatccgtctgccaagagctgggggccctctggggcttagtattgtcgga
ggctccgaccattccagccacccgtttggtgtccaggagcctggtgtgttcatctccaag
gtgctcccgcggggcctggccgctcgcagcggcctgcgggttggggaccgcatcctggca
gtgaacgggcaagacgtgcgggatgccacgcaccaagaagcagtcagtgccctgctccgg
ccctgcctggagctgtcgctgctggtgcggagggacccggcacccccgggcctacgggaa
ctgtgcatccagaaggcacctggggagaggctgggcatcagcatccgcgggggtgccagg
ggccacgctggcaacccccgcgaccccacagacgagggcatcttcatctccaaggtgagc
cccacgggggcagccgggcgcgacggtcggctgcgtgtgggtttgcggctgttggaggtg
aaccagcagagcctgctgggcctgacgcacggcgaggcggtgcagctgctccgcagtgtg
ggcgacaccctcaccgtgctggtctgtgacggcttcgaggccagcaccgacgcagccctg
gaggtgtccccaggtgtcattgccaacccctttgcggcaggcatcggccaccggaacagc
ctggagagcatctcttccatcgaccgggagctgagccctgagggcccaggcaaggagaag
gagctgcctggacagaccctgcactgggggcccgaggccacagaagccgcaggtcggggt
ctgcagcccctgaagctggactaccgcgccctggccgccgtgcccagcgctggcagcgtg
cagagggtaccgtctggagcagctggagggaagatggctgaatctccctgctcccctagt
ggccagcagccgccctccccgccttctccggatgagctgcccgccaatgtgaagcaggcc
tacagggccttcgcggccgtgcccacttctcacccgcctgaggatgcccctgcccagccc
cccacgcctgggcctgcagcctccccggagcagctgtccttccgggagcggcagaagtac
tttgagctggaggtgcgcgtgccccaggccgagggcccccctaagcgcgtgtccctggtg
ggtgctgacgacctgcggaagatgcaggaggaggaagccagaaaactacagcagaagaga
gcgcagatgctgcgggaggcggcagaggctggggccgaagcgaggctcgccctggacggg
gagacgctgggcgaggaggaacaggaggatgagcagccaccctgggccagcccgagcccc
acctcaaggcagagcccggcgtcccccccgcccctgggaggtggcgccccggtgcggacg
gccaaagctgaacggcgccaccaggagcggctgcgcgtgcagagtccggagccaccggca
cccgagcgtgccctgtcccctgccgagctccgggccctggaggccgagaagcgtgcgctg
tggagggcagccaggatgaagtcattggaacaggacgctctccgagcacagatggtcctc
agcaggtcccaggaaggccggggcacgcgggggcccctggagcgactggccgaggcccct
tcccctgcgcccaccccgtcgcccacccctgtggaagacctcggcccccagaccagcacc
tccccgggacgcctgtcaccggactttgctgaggagttgaggtccctggaaccatctccc
agccctggcccgcaggaggaggatggagaagtggctctggtgcttctgggcaggccctca
cccggcgctgtgggccctgaagatgtggcactgtgcagcagccgccgccccgtaaggcct
gggcgccgtggcctgggccctgtgccctcctag

Protein Sequence

>23513 : length: 1630
MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELG
GLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTTEL
HVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQP
PLSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSE
LKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPS
AEAQGGSQQEATTAGGEEDAEEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQ
RLIRKDTPHYKKHFKISKLPQPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPWAPRAQKE
EEEEEEGSPQEEEEEEEEENRAEEEEASTEEEDKEGAVVSAPSVKGVSFDQANNLLIEPA
RIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKL
LEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERR
GGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEG
GAAHRAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLP
HSSPPTAAVATTSITTATPGVPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLSIVG
GSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLR
PCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVS
PTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFEASTDAAL
EVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEATEAAGRG
LQPLKLDYRALAAVPSAGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQA
YRAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLV
GADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSP
TSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRAL
WRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTST
SPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRP
GRRGLGPVPS



')