Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

23385

Name

NCSTN

Synonym

APH2;nicastrin;NCSTN;nicastrin

Definition

ATAG1874|anterior pharynx-defective 2

Position

1q22-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch signaling pathway;PANTHER;P00045

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Syndecan-3-mediated signaling events;PID Curated;200170

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

Alzheimer's disease;KEGG PATHWAY;hsa05010

Pathway

Signaling by Notch;Reactome;REACT:299

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Disease

Alzheimer's disease;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to Entrez Gene

23385

Links to all GeneRIF Items

23385

Links to iHOP

23385

Sequence Information

Nucleotide Sequence

>23385 : length: 2130
atggctacggcagggggtggctctggggctgacccgggaagtcggggtctccttcgcctt
ctgtctttctgcgtcctactagcaggtttgtgcaggggaaactcagtggagaggaagata
tatatccccttaaataaaacagctccctgtgttcgcctgctcaacgccactcatcagatt
ggctgccagtcttcaattagtggagacacaggggttatccacgtagtagagaaagaggag
gacctacagtgggtattgactgatggccccaaccccccttacatggttctgctggagagc
aagcattttaccagggatttaatggagaagctgaaagggagaaccagccgaattgctggt
cttgcagtgtccttgaccaagcccagtcctgcctcaggcttctctcctagtgtacagtgc
ccaaatgatgggtttggtgtttactccaattcctatgggccagagtttgctcactgcaga
gaaatacagtggaattcgctgggcaatggtttggcttatgaagactttagtttccccatc
tttcttcttgaagatgaaaatgaaaccaaagtcatcaagcagtgctatcaagatcacaac
ctgagtcagaatggctcagcaccaaccttcccactatgtgccatgcagctcttttcacac
atgcatgctgtcatcagcactgccacctgcatgcggcgcagctccatccaaagcaccttc
agcatcaacccagaaatcgtctgtgaccccctgtctgattacaatgtgtggagcatgcta
aagcctataaatacaactgggacattaaagcctgacgacagggttgtggttgctgccacc
cggctggatagtcgttcctttttctggaatgtggccccaggggctgaaagcgcagtggct
tcctttgtcacccagctggctgctgctgaagctttgcaaaaggcacctgatgtgaccacc
ctgccccgcaatgtcatgtttgtcttctttcaaggggaaacttttgactacattggcagc
tcgaggatggtctacgatatggagaagggcaagtttcccgtgcagttagagaatgttgac
tcatttgtggagctgggacaggtggccttaagaacttcattagagctttggatgcacaca
gatcctgtttctcagaaaaatgagtctgtacggaaccaggtggaggatctcctggccaca
ttggagaagagtggtgctggtgtccctgctgtcatcctcaggaggccaaatcagtcccag
cctctcccaccatcttccctgcagcgatttcttcgagctcgaaacatctctggcgttgtt
ctggctgaccactctggtgccttccataacaaatattaccagagtatttacgacactgct
gagaacattaatgtgagctatcccgaatggctgagccctgaagaggacctgaactttgta
acagacactgccaaggccctggcagatgtggccacggtgctgggacgtgctctgtatgag
cttgcaggaggaaccaacttcagcgacacagttcaggctgatccccaaacggttacccgc
ctgctctatgggttcctgattaaagccaacaactcatggttccagtctatcctcaggcag
gacctaaggtcctacttgggtgacgggcctcttcaacattacatcgctgtctccagcccc
accaacaccacttatgttgtacagtatgccttggcaaatttgactggcacagtggtcaac
ctcacccgagagcagtgccaggatccaagtaaagtcccaagtgaaaacaaggatctgtat
gagtactcatgggtccagggccctttgcattctaatgagacggaccgactcccccggtgt
gtgcgttctactgcacgattagccagggccttgtctcctgcctttgaactgagtcagtgg
agctctactgaatactctacatggactgagagccgctggaaagatatccgtgcccggata
tttctcatcgccagcaaagagcttgagttgatcaccctgacagtgggcttcggcatcctc
atcttctccctcatcgtcacctactgcatcaatgccaaagctgatgtccttttcattgct
ccccgggagccaggagctgtgtcatactga

Protein Sequence

>23385 : length: 709
MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQI
GCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAG
LAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPI
FLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVA
SFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVD
SFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQ
PLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQ
DLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLY
EYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARI
FLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY



')