Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

23246

Name

BOP1

Synonym

-;block of proliferation 1;BOP1;block of proliferation 1

Definition

block of proliferation 1 protein|ribosome biogenesis protein BOP1

Position

8q24.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

23246

Links to all GeneRIF Items

23246

Links to iHOP

23246

Sequence Information

Nucleotide Sequence

>23246 : length: 2241
atggcgggttcgcggggtgcggggcgcacggcggcgccgagcgtgcggccggagaagcgg
cggtctgagcccgaactggagcctgagcccgagccggagccccccctcctctgcacctct
cctctcagccacagcaccggcagcgattctggcgtctccgacagcgaggagagtgtgttc
tcaggcctggaagattccggcagtgacagcagtgaggatgatgacgaaggcgacgaggag
ggagaggacggagcccttgatgacgagggccacagtgggattaaaaagaccactgaggag
caggtgcaggccagcactccttgcccgaggacagagatggcgagcgcccggattggggat
gagtatgcggaggacagctctgatgaggaggacatccggaacacggtgggcaacgtgccc
ttggagtggtacgatgacttcccccacgtgggctacgacctggatggcaggcgcatctac
aagcccctgcggacccgggatgagctggaccagttcctggacaagatggacgatcctgac
tactggcgcaccgtgcaggacccgatgacagggcgggacctgagactgacggatgagcag
gtggccctggtgcggcggctgcagagtggccagtttggggatgtgggcttcaacccctat
gagccggctgtcgacttcttcagcggggacgtcatgatccacccggtgaccaaccgcccg
gccgacaagcgcagcttcatcccctccctggtggagaaggagaaggtctctcgcatggtg
cacgccatcaagatgggctggatccagcctcgccggccccgagaccccacccccagcttc
tatgacctgtgggcccaggaggaccccaacgccgtgctcgggcgccacaagatgcacgta
cctgctcccaagctggccctgccaggccacgccgagtcgtacaacccaccccctgaatac
ctgctcagcgaggaggagcgcttggcgtgggaacagcaggagccaggcgagaggaagctg
agctttttgccacgcaagttcccgagcctgcgggccgtgcctgcctacggacgcttcatc
caggaacgcttcgagcgctgccttgacctgtacctgtgcccacggcagcgcaagatgagg
gtgaatgtagaccctgaggacctcatccccaagctgcctcggccgagggacctgcagccc
ttccccacgtgccaggccctggtctacaggggccacagtgaccttgtccggtgcctcagt
gtctctcctgggggccagtggctggtttcaggctctgacgacggctccctgcggctctgg
gaggtggccactgcccgctgtgtgaggactgttcccgtggggggcgtggtgaagagtgtg
gcctggaaccccagccccgctgtctgcctggtggctgcagccgtggaggactcggtgctg
ctgctgaacccagctctgggggaccggctggtggcgggcagcacagatcagctgttgagc
gccttcgtcccgcctgaggagccccccttgcagccggcccgctggctggaggcctcagag
gaggagcgccaagtgggcctgcggctgcgcatctgccacgggaagccagtgacgcaggtg
acctggcacgggcgtggggactacctggccgtggtgctggccacccaaggccacacccag
gtgctgattcaccagctgagccgtcgccgcagccagagtccgttccgccgcagccacgga
caggtgcagcgagtggccttccaccctgcccggcccttcctgttggtggcgtcccagcgc
agcgtccgcctctaccacctgctgcgccaggagctcaccaagaagctgatgcccaactgc
aagtgggtgtccagcctggcggtgcaccctgcaggtgacaacgtcatctgtgggagctac
gatagcaagctggtgtggtttgacctggatctttccaccaagccatacaggatgctgaga
caccacaagaaggctctgcgggctgtggccttccacccgcggtacccactctttgcgtca
ggctcggacgacggcagtgtcatcgtctgccatggcatggtgtacaatgaccttctgcag
aaccccttgctggtgcccgtcaaggtgctgaagggacacgtgctgacccgagatctggga
gtgctggacgtcatcttccaccccacccagccgtgggtcttctcctcgggggcagacggg
actgtccgcctcttcacctag

Protein Sequence

>23246 : length: 746
MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVF
SGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGD
EYAEDSSDEEDIRNTVGNVPLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPD
YWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEPAVDFFSGDVMIHPVTNRP
ADKRSFIPSLVEKEKVSRMVHAIKMGWIQPRRPRDPTPSFYDLWAQEDPNAVLGRHKMHV
PAPKLALPGHAESYNPPPEYLLSEEERLAWEQQEPGERKLSFLPRKFPSLRAVPAYGRFI
QERFERCLDLYLCPRQRKMRVNVDPEDLIPKLPRPRDLQPFPTCQALVYRGHSDLVRCLS
VSPGGQWLVSGSDDGSLRLWEVATARCVRTVPVGGVVKSVAWNPSPAVCLVAAAVEDSVL
LLNPALGDRLVAGSTDQLLSAFVPPEEPPLQPARWLEASEEERQVGLRLRICHGKPVTQV
TWHGRGDYLAVVLATQGHTQVLIHQLSRRRSQSPFRRSHGQVQRVAFHPARPFLLVASQR
SVRLYHLLRQELTKKLMPNCKWVSSLAVHPAGDNVICGSYDSKLVWFDLDLSTKPYRMLR
HHKKALRAVAFHPRYPLFASGSDDGSVIVCHGMVYNDLLQNPLLVPVKVLKGHVLTRDLG
VLDVIFHPTQPWVFSSGADGTVRLFT



')