Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2321

Name

FLT1

Synonym

FLT|VEGFR1;fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);FLT1;fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)

Definition

FLT-1|VEGFR-1|fms-like tyrosine kinase 1|tyrosine-protein kinase FRT|tyrosine-protein kinase receptor FLT|vascular endothelial growth factor receptor 1|vascular permeability factor receptor

Position

13q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Signaling by VEGF;Reactome;REACT:12529

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

Glypican 1 network;PID Curated;200021

Disease

Cognitive performance;GAD

Disease

Cognitive performance;NHGRI

Disease

NEUROLOGICAL;GAD

External Links

Links to Entrez Gene

2321

Links to all GeneRIF Items

2321

Links to iHOP

2321

Sequence Information

Nucleotide Sequence

>2321 : length: 2064
atggtcagctactgggacaccggggtcctgctgtgcgcgctgctcagctgtctgcttctc
acaggatctagttcaggttcaaaattaaaagatcctgaactgagtttaaaaggcacccag
cacatcatgcaagcaggccagacactgcatctccaatgcaggggggaagcagcccataaa
tggtctttgcctgaaatggtgagtaaggaaagcgaaaggctgagcataactaaatctgcc
tgtggaagaaatggcaaacaattctgcagtactttaaccttgaacacagctcaagcaaac
cacactggcttctacagctgcaaatatctagctgtacctacttcaaagaagaaggaaaca
gaatctgcaatctatatatttattagtgatacaggtagacctttcgtagagatgtacagt
gaaatccccgaaattatacacatgactgaaggaagggagctcgtcattccctgccgggtt
acgtcacctaacatcactgttactttaaaaaagtttccacttgacactttgatccctgat
ggaaaacgcataatctgggacagtagaaagggcttcatcatatcaaatgcaacgtacaaa
gaaatagggcttctgacctgtgaagcaacagtcaatgggcatttgtataagacaaactat
ctcacacatcgacaaaccaatacaatcatagatgtccaaataagcacaccacgcccagtc
aaattacttagaggccatactcttgtcctcaattgtactgctaccactcccttgaacacg
agagttcaaatgacctggagttaccctgatgaaaaaaataagagagcttccgtaaggcga
cgaattgaccaaagcaattcccatgccaacatattctacagtgttcttactattgacaaa
atgcagaacaaagacaaaggactttatacttgtcgtgtaaggagtggaccatcattcaaa
tctgttaacacctcagtgcatatatatgataaagcattcatcactgtgaaacatcgaaaa
cagcaggtgcttgaaaccgtagctggcaagcggtcttaccggctctctatgaaagtgaag
gcatttccctcgccggaagttgtatggttaaaagatgggttacctgcgactgagaaatct
gctcgctatttgactcgtggctactcgttaattatcaaggacgtaactgaagaggatgca
gggaattatacaatcttgctgagcataaaacagtcaaatgtgtttaaaaacctcactgcc
actctaattgtcaatgtgaaaccccagatttacgaaaaggccgtgtcatcgtttccagac
ccggctctctacccactgggcagcagacaaatcctgacttgtaccgcatatggtatccct
caacctacaatcaagtggttctggcacccctgtaaccataatcattccgaagcaaggtgt
gacttttgttccaataatgaagagtcctttatcctggatgctgacagcaacatgggaaac
agaattgagagcatcactcagcgcatggcaataatagaaggaaagaataagatggctagc
accttggttgtggctgactctagaatttctggaatctacatttgcatagcttccaataaa
gttgggactgtgggaagaaacataagcttttatatcacagatgtgccaaatgggtttcat
gttaacttggaaaaaatgccgacggaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagacgttacttggattttactgcggacagttaataacagaacaatg
cactacagtattagcaagcaaaaaatggccatcactaaggagcactccatcactcttaat
cttaccatcatgaatgtttccctgcaagattcaggcacctatgcctgcagagccaggaat
gtatacacaggggaagaaatcctccagaagaaagaaattacaatcagaggtgagcactgc
aacaaaaaggctgttttctctcggatctccaaatttaaaagcacaaggaatgattgtacc
acacaaagtaatgtaaaacattaa

Protein Sequence

>2321 : length: 687
MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK
WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRGEHC
NKKAVFSRISKFKSTRNDCTTQSNVKH



')