Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

23129

Name

PLXND1

Synonym

PLEXD1;plexin D1;PLXND1;plexin D1

Definition

plexin-D1

Position

3q22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Other semaphorin interactions;PID Reactome;500078

Pathway

Axon guidance;Reactome;REACT:18266

External Links

Links to Entrez Gene

23129

Links to all GeneRIF Items

23129

Links to iHOP

23129

Sequence Information

Nucleotide Sequence

>23129 : length: 5778
atggctcctcgcgccgcgggcggcgcaccccttagcgcccgggccgccgccgccagcccc
ccgccgttccagacgccgccgcggtgcccggtgccgctgctgttgctgctgctcctgggg
gcggcgcgggccggcgccctggagatccagcgtcggttcccctcgcccacgcccaccaac
aacttcgccctggacggcgcggcggggaccgtgtacctggcggccgtcaaccgcctctat
cagctgtcgggcgccaacctgagcctggaggccgaggcggccgtgggcccggtgcccgac
agcccgctgtgtcacgctccgcagctgccgcaggcctcgtgcgagcacccgcggcgcctc
acggacaactacaacaagatcctgcagctggaccccggccagggcctggtagtcgtgtgc
gggtccatctaccagggcttctgccagctgcggcgccggggcaacatctcggccgtggcc
gtgcgcttcccgcccgccgcgccgcccgccgagcccgtcacggtgttccccagcatgctg
aacgtggcggccaaccacccgaacgcgtccaccgtggggctagttctgcctcccgccgcg
ggcgcggggggcagccgcctgctcgtgggcgccacgtacaccggttacggcagctccttc
ttcccgcgcaaccgcagcctggaggaccaccgcttcgagaacacgcccgagatcgccatc
cgctccctggacacgcgcggcgacctggccaagctcttcaccttcgacctcaacccctcc
gacgacaacatcctcaagatcaagcagggcgccaaggagcagcacaagctgggcttcgtg
agcgccttcctgcacccgtccgacccgccgccgggtgcacagtcctacgcgtacctggcg
ctcaacagcgaggcgcgcgcgggcgacaaggagagccaggcgcggagcctgctggcgcgc
atctgcctgccccacggcgccggcggcgacgccaagaagctcaccgagtcctacatccag
ttgggcttgcagtgcgcgggcggcgcgggccgcggcgacctctacagccgcctggtgtcg
gtcttcccagcccgggagcggctctttgctgtcttcgagcggccccaggggtcccccgcg
gcccgcgctgctccggccgcactctgcgccttccgcttcgccgacgtgcgagccgccatc
cgagctgcgcgcaccgcctgcttcgtggaaccggcgcccgacgtggtggcggtgctcgac
agcgtggtgcagggcacgggaccggcctgcgagcgcaagctcaacatccagctccagcca
gagcagctggactgtggagctgctcacctgcagcacccgctgtccatcctgcagcccctg
aaggccacgcccgtgttccgcgccccgggcctcacctccgtggccgtggccagcgtcaac
aactacacagcggtcttcctgggcacggtcaacgggaggcttctcaagatcaacctgaac
gagagcatgcaggtggtgagcaggcgggtggtgactgtggcctatggggagcccgtgcac
catgtcatgcagtttgacccagcagactccggttacctttacctgatgacgtcccaccag
atggccagggtgaaggtcgccgcctgcaacgtgcactccacctgtggggactgcgtgggt
gcggcggacgcctactgcggctggtgtgccctggagacgcggtgcaccttgcagcaggac
tgcaccaattccagccagcagcatttctggaccagtgccagcgagggccccagccgctgt
cctgccatgaccgtcctgccttccgagatcgatgtgcgccaggagtacccaggcatgatc
ctgcagatctcgggcagcctgcccagcctcagtggcatggagatggcctgtgactatggg
aacaacatccgcactgtggctcgggtcccaggccctgcctttggtcaccagattgcctac
tgcaacctcctgccgagggaccagtttccgcccttcccccccaaccaggaccacgtgact
gttgagatgtctgtgagggtcaatgggcggaacatcgtcaaggccaatttcaccatctac
gactgcagccgcactgcacaagtgtacccccacacagcctgtaccagctgcctgtcggca
cagtggccctgtttctggtgcagccagcagcactcctgtgtttccaaccagtctcggtgc
gaggcctcaccaaaccccacgagccctcaggactgcccccggaccctgctctcacccctg
gcacccgtgcctacgggtggctcccagaacatcctggtgcctctggccaacactgccttt
ttccagggtgcagccctggagtgtagttttgggctggaggagatcttcgaggctgtgtgg
gtgaatgagtctgttgtacgctgtgaccaggtggtgctgcacacgacccggaagagccag
gtgttcccgctcagcctccaactaaaggggcggccagcccgattcctggacagccctgag
cccatgacagtcatggtctataactgtgccatgggcagccccgactgttcccagtgcctg
ggccgcgaagacctgggtcacctgtgcatgtggagtgatggctgccgcctgcgggggcct
ctgcagcccatggctggcacctgccccgcccccgagatccgcgcgattgagcccctgagt
ggcccgttggacggtgggaccctgctgaccatccgaggaaggaacctgggccggcggctc
agtgacgtggcccacggcgtgtggattggtggtgtggcctgtgagccactgcctgacaga
tacacggtgtcggaggagatcgtgtgtgtcacagggccagccccaggaccactctcaggt
gtggtgaccgtgaacgcctctaaggagggcaagtcccgggaccgcttctcctacgtgctg
cccctggtccactccctggagcctaccatgggccccaaggccgggggcaccaggatcacc
atccatgggaatgacctccatgtaggctccgagctccaggtcctggtgaacgacacagac
ccctgcacggagctgatgcgcacagataccagcatcgcctgcaccatgcctgagggggcc
ctgccggctccggtgcctgtgtgtgtgcgcttcgagcgtcggggctgcgtgcacggcaac
ctcaccttctggtacatgcagaacccggtcatcacggccatcagtccccgccgcagccct
gtcagtggcggcaggaccatcacagtggctggtgagcgtttccacatggtgcagaatgtg
tccatggccgtccaccacattggccgggagcccacgctctgcaaggttctcaactccacc
ctcatcacctgcccgtcccccggggccctgagcaacgcatcagcgccagtggacttcttc
atcaatgggcgggcctacgcagacgaggtggctgtggctgaggagctactggaccccgag
gaggcacagcggggcagcaggttccgcctggactacctccccaacccacagttctctacg
gccaagagggagaagtggatcaagcaccaccccggggagcctctcaccctcgttatccac
aaggagcaggacagcctggggctccagagtcacgagtaccgggtcaagataggccaagta
agctgcgacatccagattgtctctgacagaatcatccactgctcggtcaacgagtccctg
ggcgcggccgtggggcagctgcccatcacaatccaggtagggaacttcaaccagaccatc
gccacactgcagctggggggcagcgagacggccatcatcgtgtccatcgtcatctgcagc
gtcctgctgctgctctccgtggtggccctgttcgtcttctgtaccaagagccgacgtgct
gagcgttactggcagaagacgctgctgcagatggaggagatggaatctcagatccgagag
gaaatccgcaaaggcttcgctgagctgcagacagacatgacagatctcaccaaggagctg
aaccgcagccagggcatccccttcctggagtataagcacttcgtgacccgcaccttcttc
cccaagtgttcctccctttatgaagagcgttacgtgctgccctcccagaccctcaactcc
cagggcagctcccaggcacaggaaacccacccactgctgggagagtggaagattcctgag
agctgccggcccaacatggaagagggaattagcttgttctcctcactactcaacaacaag
cacttcctcatcgtctttgtccacgcgctggagcagcagaaggactttgcggtgcgcgac
aggtgcagcctggcctcgctgctgaccatcgcgctgcacggcaagctggagtactacacc
agcatcatgaaggagctgctggtggacctcattgacgcctcggccgccaagaaccccaag
ctcatgctgcggcgcacagagtctgtggtggagaagatgctcaccaactggatgtccatc
tgcatgtacagctgtctgcgggagacggtgggggagccattcttcctgctgctgtgtgcc
atcaagcagcaaatcaacaagggctccatcgacgccatcacaggcaaggcccgctacaca
ctcaatgaggagtggctgctgcgggagaacatcgaggccaagccccggaacctgaacgtg
tccttccagggctgtggcatggactcgctgagcgtgcgggccatggacaccgacacgctg
acacaggtcaaggagaagatcctggaggccttctgcaagaatgtgccctactcccagtgg
ccgcgtgcagaggacgtcgaccttgagtggttcgcctccagcacacagagctacatcctt
cgggacctggacgacacctcagtggtggaagacggccgcaagaagcttaacacgctggcc
cattacaagatccctgaaggtgcctccctggccatgagtctcatagacaagaaggacaac
acactgggccgagtgaaagacttggacacagagaagtatttccatttggtgctgcctacg
gacgagctggcggagcccaagaagtctcaccggcagagccatcgcaagaaggtgctcccg
gaaatctacctgacccgcctgctctccaccaagggcacgttgcagaagtttctggatgac
ctgttcaaggccattctgagtatccgtgaagacaagcccccactggctgtcaagtacttt
ttcgacttcctggaggagcaggctgagaagaggggaatctccgaccccgacaccctacac
atctggaagaccaacagccttcctctccggttctgggtgaacatcctgaagaacccccag
tttgtctttgacatcgacaagacagaccacatcgacgcctgcctttcagtcatcgcgcag
gccttcatcgacgcctgctccatctctgacctgcagctgggcaaggattcgccaaccaac
aagctcctctacgccaaggagattcctgagtaccggaagatcgtgcagcgctactacaag
cagatccaggacatgacgccgctcagcgagcaagagatgaatgcccatctggccgaggag
tcgaggaaataccagaatgagttcaacaccaatgtggccatggcagagatttataagtac
gccaagaggtatcggccgcagatcatggccgcgctggaggccaaccccacggcccggagg
acacaactgcagcacaagtttgagcaggtggtggctttgatggaggacaacatctacgag
tgctacagtgaggcctga

Protein Sequence

>23129 : length: 1925
MAPRAAGGAPLSARAAAASPPPFQTPPRCPVPLLLLLLLGAARAGALEIQRRFPSPTPTN
NFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRRL
TDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSML
NVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEIAI
RSLDTRGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPSDPPPGAQSYAYLA
LNSEARAGDKESQARSLLARICLPHGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVS
VFPARERLFAVFERPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLD
SVVQGTGPACERKLNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLTSVAVASVN
NYTAVFLGTVNGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQ
MARVKVAACNVHSTCGDCVGAADAYCGWCALETRCTLQQDCTNSSQQHFWTSASEGPSRC
PAMTVLPSEIDVRQEYPGMILQISGSLPSLSGMEMACDYGNNIRTVARVPGPAFGHQIAY
CNLLPRDQFPPFPPNQDHVTVEMSVRVNGRNIVKANFTIYDCSRTAQVYPHTACTSCLSA
QWPCFWCSQQHSCVSNQSRCEASPNPTSPQDCPRTLLSPLAPVPTGGSQNILVPLANTAF
FQGAALECSFGLEEIFEAVWVNESVVRCDQVVLHTTRKSQVFPLSLQLKGRPARFLDSPE
PMTVMVYNCAMGSPDCSQCLGREDLGHLCMWSDGCRLRGPLQPMAGTCPAPEIRAIEPLS
GPLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEEIVCVTGPAPGPLSG
VVTVNASKEGKSRDRFSYVLPLVHSLEPTMGPKAGGTRITIHGNDLHVGSELQVLVNDTD
PCTELMRTDTSIACTMPEGALPAPVPVCVRFERRGCVHGNLTFWYMQNPVITAISPRRSP
VSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFF
INGRAYADEVAVAEELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
KEQDSLGLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAVGQLPITIQVGNFNQTI
ATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIRE
EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNS
QGSSQAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYIL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPT
DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYE
CYSEA



')