Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2305

Name

FOXM1

Synonym

FKHL16|FOXM1B|HFH-11|HFH11|HNF-3|INS-1|MPHOSPH2|MPP-2|MPP2|PIG29|TGT3|TRIDENT;forkhead box M1;FOXM1;forkhead box M1

Definition

Forkhead, drosophila, homolog-like 16|HNF-3/fork-head homolog 11|M-phase phosphoprotein 2|MPM-2 reactive phosphoprotein 2|forkhead box protein M1|forkhead-related protein FKHL16|hepatocyte nuclear factor 3 forkhead homolog 11|transcription factor Trident|

Position

12p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

FOXM1 transcription factor network;PID Curated;200120

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

2305

Links to all GeneRIF Items

2305

Links to iHOP

2305

Sequence Information

Nucleotide Sequence

>2305 : length: 2292
atgaaaactagcccccgtcggccactgattctcaaaagacggaggctgccccttcctgtt
caaaatgccccaagtgaaacatcagaggaggaacctaagagatcccctgcccaacaggag
tctaatcaagcagaggcctccaaggaagtggcagagtccaactcttgcaagtttccagct
gggatcaagattattaaccaccccaccatgcccaacacgcaagtagtggccatccccaac
aatgctaatattcacagcatcatcacagcactgactgccaagggaaaagagagtggcagt
agtgggcccaacaaattcatcctcatcagctgtgggggagccccaactcagcctccagga
ctccggcctcaaacccaaaccagctatgatgccaaaaggacagaagtgaccctggagacc
ttgggaccaaaacctgcagctagggatgtgaatcttcctagaccacctggagccctttgc
gagcagaaacgggagacctgtgcagatggtgaggcagcaggctgcactatcaacaatagc
ctatccaacatccagtggcttcgaaagatgagttctgatggactgggctcccgcagcatc
aagcaagagatggaggaaaaggagaattgtcacctggagcagcgacaggttaaggttgag
gagccttcgagaccatcagcgtcctggcagaactctgtgtctgagcggccaccctactct
tacatggccatgatacaattcgccatcaacagcactgagaggaagcgcatgactttgaaa
gacatctatacgtggattgaggaccactttccctactttaagcacattgccaagccaggc
tggaagaactccatccgccacaacctttccctgcacgacatgtttgtccgggagacgtct
gccaatggcaaggtctccttctggaccattcaccccagtgccaaccgctacttgacattg
gaccaggtgtttaagccactggacccagggtctccacaattgcccgagcacttggaatca
cagcagaaacgaccgaatccagagctccgccggaacatgaccatcaaaaccgaactcccc
ctgggcgcacggcggaagatgaagccactgctaccacgggtcagctcatacctggtacct
atccagttcccggtgaaccagtcactggtgttgcagccctcggtgaaggtgccattgccc
ctggcggcttccctcatgagctcagagcttgcccgccatagcaagcgagtccgcattgcc
cccaaggtgctgctagctgaggaggggatagctcctctttcttctgcaggaccagggaaa
gaggagaaactcctgtttggagaagggttttctcctttgcttccagttcagactatcaag
gaggaagaaatccagcctggggaggaaatgccacacttagcgagacccatcaaagtggag
agccctcccttggaagagtggccctccccggccccatctttcaaagaggaatcatctcac
tcctgggaggattcgtcccaatctcccaccccaagacccaagaagtcctacagtgggctt
aggtccccaacccggtgtgtctcggaaatgcttgtgattcaacacagggagaggagggag
aggagccggtctcggaggaaacagcatctactgcctccctgtgtggatgagccggagctg
ctcttctcagaggggcccagtacttcccgctgggccgcagagctcccgttcccagcagac
tcctctgaccctgcctcccagctcagctactcccaggaagtgggaggaccttttaagaca
cccattaaggaaacgctgcccatctcctccaccccgagcaaatctgtcctccccagaacc
cctgaatcctggaggctcacgcccccagccaaagtagggggactggatttcagcccagta
caaacctcccagggtgcctctgaccccttgcctgaccccctggggctgatggatctcagc
accactcccttgcaaagtgctcccccccttgaatcaccgcaaaggctcctcagttcagaa
cccttagacctcatctccgtcccctttggcaactcttctccctcagatatagacgtcccc
aagccaggctccccggagccacaggtttctggccttgcagccaatcgttctctgacagaa
ggcctggtcctggacacaatgaatgacagcctcagcaagatcctgctggacatcagcttt
cctggcctggacgaggacccactgggccctgacaacatcaactggtcccagtttattcct
gagctacagtag

Protein Sequence

>2305 : length: 763
MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
GIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPG
LRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS
LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYS
YMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVE
SPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRE
RSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLS
TTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTE
GLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ



')