Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2296

Name

FOXC1

Synonym

ARA|FKHL7|FREAC-3|FREAC3|IGDA|IHG1|IRID1|RIEG3;forkhead box C1;FOXC1;forkhead box C1

Definition

forkhead box protein C1|forkhead, drosophila, homolog-like 7|forkhead-related activator 3|forkhead-related protein FKHL7|forkhead-related transcription factor 3|forkhead/winged helix-like transcription factor 7|myeloid factor-delta

Position

6p25

Gene Type

protein-coding

External Links

Links to Entrez Gene

2296

Links to all GeneRIF Items

2296

Links to iHOP

2296

Sequence Information

Nucleotide Sequence

>2296 : length: 1662
atgcaggcgcgctactccgtgtccagccccaactccctgggagtggtgccctacctcggc
ggcgagcagagctactaccgcgcggcggccgcggcggccgggggcggctacaccgccatg
ccggcccccatgagcgtgtactcgcaccctgcgcacgccgagcagtacccgggcggcatg
gcccgcgcctacgggccctacacgccgcagccgcagcccaaggacatggtgaagccgccc
tatagctacatcgcgctcatcaccatggccatccagaacgccccggacaagaagatcacc
ctgaacggcatctaccagttcatcatggaccgcttccccttctaccgggacaacaagcag
ggctggcagaacagcatccgccacaacctctcgctcaacgagtgcttcgtcaaggtgccg
cgcgacgacaagaagccgggcaagggcagctactggacgctggacccggactcctacaac
atgttcgagaacggcagcttcctgcggcggcggcggcgcttcaagaagaaggacgcggtg
aaggacaaggaggagaaggacaggctgcacctcaaggagccgcccccgcccggccgccag
cccccgcccgcgccgccggagcaggccgacggcaacgcgcccggtccgcagccgccgccc
gtgcgcatccaggacatcaagaccgagaacggtacgtgcccctcgccgccccagcccctg
tccccggccgccgccctgggcagcggcagcgccgccgcggtgcccaagatcgagagcccc
gacagcagcagcagcagcctgtccagcgggagcagccccccgggcagcctgccgtcggcg
cggccgctcagcctggacggtgcggattccgcgccgccgccgcccgcgccctccgccccg
ccgccgcaccatagccagggcttcagcgtggacaacatcatgacgtcgctgcgggggtcg
ccgcagagcgcggccgcggagctcagctccggccttctggcctcggcggccgcgtcctcg
cgcgcggggatcgcacccccgctggcgctcggcgcctactcgcccggccagagctccctc
tacagctccccctgcagccagacctccagcgcgggcagctcgggcggcggcggcggcggc
gcgggggccgcggggggcgcgggcggcgccgggacctaccactgcaacctgcaagccatg
agcctgtacgcggccggcgagcgcgggggccacttgcagggcgcgcccgggggcgcgggc
ggctcggccgtggacgaccccctgcccgactactctctgcctccggtcaccagcagcagc
tcgtcgtccctgagtcacggcggcggcggcggcggcggcgggggaggccaggaggccggc
caccaccctgcggcccaccaaggccgcctcacctcgtggtacctgaaccaggcgggcgga
gacctgggccacttggcgagcgcggcggcggcggcggcggccgcaggctacccgggccag
cagcagaacttccactcggtgcgggagatgttcgagtcacagaggatcggcttgaacaac
tctccagtgaacgggaatagtagctgtcaaatggccttcccttccagccagtctctgtac
cgcacgtccggagctttcgtctacgactgtagcaagttttga

Protein Sequence

>2296 : length: 553
MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGM
ARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQ
GWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAV
KDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPL
SPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAP
PPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSL
YSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAG
GSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGG
DLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLY
RTSGAFVYDCSKF



')