Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

22938

Name

SNW1

Synonym

Bx42|NCOA-62|PRPF45|Prp45|SKIIP|SKIP;SNW domain containing 1;SNW1;SNW domain containing 1

Definition

SKI interacting protein|SKI-interacting protein|SNW domain-containing protein 1|homolog of Drosophila BX42|nuclear protein SkiP|nuclear receptor coactivator NCoA-62|nuclear receptor coactivator, 62-kD

Position

14q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Spliceosome;KEGG PATHWAY;hsa03040

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

Notch-HLH transcription pathway;PID Reactome;500905

Pathway

Gene Expression;Reactome;REACT:71

External Links

Links to Entrez Gene

22938

Links to all GeneRIF Items

22938

Links to iHOP

22938

Sequence Information

Nucleotide Sequence

>22938 : length: 1611
atggcgctcaccagctttttacctgcacctactcagctatctcaggaccagcttgaggct
gaagaaaaggcaagatcccagagatcacggcagacctcactggtctcctcccgaagagaa
cctcccccgtacggataccggaaaggctggatacctcggttattagaggattttggagat
ggaggtgcttttccagagatccatgtggcccagtatccactggatatgggacgaaagaaa
aaaatgtcgaatgcgctggccattcaggtggattctgaaggaaaaattaaatatgatgca
attgctcgacaaggacagtcaaaagacaaggtcatttatagcaaatacactgacctggtt
ccaaaggaggttatgaatgcagatgatccagacctgcaaaggcccgatgaagaagctatt
aaagagataacagaaaagacaagagtagccttagaaaaatctgtatcacagaaggtcgcc
gcagccatgccagttcgagcagctgacaaattggctcctgctcagtatatccgatacaca
ccatctcagcaaggagtggcattcaactctggagctaaacagagggttattcggatggta
gaaatgcagaaagatccaatggagcctccaaggttcaagattaataagaaaattccccgg
ggaccaccttctcctcctgcgcctgtcatgcattctcctagccgaaagatgactgtaaag
gaacaacaagagtggaagattcctccttgtatttctaactggaaaaatgcaaagggttat
acaattccattagacaaacgtctggctgctgatggaagaggactacagacagtacacata
aatgaaaatttcgccaaattggcagaagccctctacattgctgatcggaaggctcgtgaa
gctgtggaaatgcgtgcccaagtagagagaaaaatggctcagaaagaaaaggaaaaacat
gaagagaaacttagagaaatggcccagaaagccagggagagaagagctgggatcaaaact
catgtggaaaaagaggatggggaggcacgtgagagggatgaaatccggcatgacaggcga
aaagagagacagcatgaccggaatctttccagggcagctcctgataagaggtcgaaactt
cagagaaatgaaaatcgggatatcagtgaagttattgctctcggtgttcctaatcctcgg
acttccaatgaagttcagtatgaccaaaggctcttcaaccaatccaagggtatggacagt
ggatttgcaggtggagaagatgaaatttataatgtttatgatcaagcctggagaggtggt
aaagatatggcccagagtatttataggcccagtaaaaatctggacaaggacatgtatggt
gatgacctagaagccagaataaagaccaacagatttgttcccgacaaggagttttctggt
tcagaccgtagacagagaggccgagaaggaccagtgcagtttgaggaagatccttttggt
ttggacaagtttttggaagaagccaaacagcatggtggctctaaaagaccctcagatagc
agccgccccaaggaacacgagcatgaaggcaagaagaggaggaaggaatag

Protein Sequence

>22938 : length: 536
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE



')