Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

22822

Name

PHLDA1

Synonym

DT1P1B11|PHRIP|TDAG51;pleckstrin homology-like domain, family A, member 1;PHLDA1;pleckstrin homology-like domain, family A, member 1

Definition

PQ-rich protein|PQR protein|T-cell death-associated gene 51 protein|apoptosis-associated nuclear protein|pleckstrin homology-like domain family A member 1|proline- and glutamine-rich protein|proline- and histidine-rich protein|proline-histidine rich prote

Position

12q15

Gene Type

protein-coding

External Links

Links to Entrez Gene

22822

Links to all GeneRIF Items

22822

Links to iHOP

22822

Sequence Information

Nucleotide Sequence

>22822 : length: 1206
atgaggcgtgcgccggctgccgagcgcctcttggagctgggctttcccccgcggtgcggg
cgccaggagccgccttttccgctgggtgtcactcgggggtggggaagatggcccattcaa
aagcgccgcgagggggcccggccagtgcccttcagtgagcgctcgcaagaggacggcaga
ggcccggcagctcggagctccgggaccttgtggcgcatcaggacgcggctgtccctctgc
cgggacccagagccgccgccgccgctctgcctcctgcgtgttagcctcctctgcgcgctc
cgggcaggcggccgtgggagccgctggggcgaggacggcgcgaggctgctgctgctgccc
ccggcccgcgcggctggaaacggagaggccgagccaagcggcggcccctcttatgctggg
aggatgctggagagtagcggctgcaaagcgctgaaggagggcgtgctggagaagcgcagc
gacgggttgttgcagctctggaagaaaaagtgttgcatcctcaccgaggaagggctgctg
cttatcccgcccaagcagctgcaacaccagcagcagcagcagcaacagcagcagcagcag
cagcaacaacagcccgggcaggggccggccgagccgtcccaacccagtggccccgctgtc
gccagcctcgagccgccggtcaagctcaaggaactgcacttctccaacatgaagaccgtg
gactgtgtggagcgcaagggcaagtacatgtacttcactgtggtgatggcagagggcaag
gagatcgactttcggtgcccgcaagaccagggctggaacgccgagatcacgctgcagatg
gtgcagtacaagaatcgtcaggccatcctggcggtcaaatccacgcggcagaagcagcag
cacctggtccagcagcagcccccctcgcagccgcagccgcagccgcagctccagccccaa
ccccagcctcagcctcagccgcaaccccagccccaatcacaaccccagcctcagccccaa
cccaagcctcagccccagcagctccacccgtatccgcatccacatccacatccacactct
catcctcactcgcacccacaccctcacccgcacccgcatccgcaccaaataccgcaccca
cacccacagccgcactcgcagccgcacgggcaccggcttctccgcagcacctccaactct
gcctga

Protein Sequence

>22822 : length: 401
MRRAPAAERLLELGFPPRCGRQEPPFPLGVTRGWGRWPIQKRREGARPVPFSERSQEDGR
GPAARSSGTLWRIRTRLSLCRDPEPPPPLCLLRVSLLCALRAGGRGSRWGEDGARLLLLP
PARAAGNGEAEPSGGPSYAGRMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLL
LIPPKQLQHQQQQQQQQQQQQQQQPGQGPAEPSQPSGPAVASLEPPVKLKELHFSNMKTV
DCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQ
HLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQPQPKPQPQQLHPYPHPHPHPHS
HPHSHPHPHPHPHPHQIPHPHPQPHSQPHGHRLLRSTSNSA



')