Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2274

Name

FHL2

Synonym

AAG11|DRAL|FHL-2|SLIM-3|SLIM3;four and a half LIM domains 2;FHL2;four and a half LIM domains 2

Definition

LIM domain protein DRAL|aging-associated gene 11|down-regulated in rhabdomyosarcoma LIM protein|four and a half LIM domains protein 2|four and a half LIM-domain protein 2|skeletal muscle LIM-protein 3

Position

2q12.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Metabolism of lipids and lipoproteins;Reactome;REACT:22258

Pathway

Signaling events mediated by HDAC Class III;PID Curated;200020

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Disease

Embryoma;FunDO

Disease

Polyarthritis;FunDO

Disease

Gastrointestinal cancer;FunDO

Disease

Breast cancer;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to Entrez Gene

2274

Links to all GeneRIF Items

2274

Links to iHOP

2274

Sequence Information

Nucleotide Sequence

>2274 : length: 840
atgactgagcgctttgactgccaccattgcaacgaatctctctttggcaagaagtacatc
ctgcgggaggagagcccctactgcgtggtgtgctttgagaccctgttcgccaacacctgc
gaggagtgtgggaagcccatcggctgtgactgcaaggacttgtcttacaaggaccggcac
tggcatgaagcctgtttccactgctcgcagtgcagaaactcactggtggacaagcccttt
gctgccaaggaggaccagctgctctgtacagactgctattccaacgagtactcatccaag
tgccaggaatgcaagaagaccatcatgccaggtacccgcaagatggagtacaagggcagc
agctggcatgagacctgcttcatctgccaccgctgccagcagccaattggaaccaagagt
ttcatccccaaagacaatcagaatttctgtgtgccctgctatgagaaacaacatgccatg
cagtgcgttcagtgcaaaaagcccatcaccacgggaggggtcacttaccgggagcagccc
tggcacaaggagtgcttcgtgtgcaccgcctgcaggaagcagctgtctgggcagcgcttc
acagctcgcgatgactttgcctactgcctgaactgcttctgtgacttgtatgccaagaag
tgtgctgggtgcaccaaccccatcagcggacttggtggcacaaaatacatctcctttgag
gaacggcagtggcataacgactgctttaactgtaagaagtgctccctctcactggtgggg
cgtggcttcctcacagagagggacgacatcctgtgccccgactgtgggaaagacatctga

Protein Sequence

>2274 : length: 279
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRH
WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGS
SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQP
WHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFE
ERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI



')