Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2263

Name

FGFR2

Synonym

BEK|BFR-1|CD332|CEK3|CFD1|ECT1|JWS|K-SAM|KGFR|TK14|TK25;fibroblast growth factor receptor 2;FGFR2;fibroblast growth factor receptor 2

Definition

BEK fibroblast growth factor receptor|FGF receptor|FGFR-2|bacteria-expressed kinase|hydroxyaryl-protein kinase|keratinocyte growth factor receptor|protein tyrosine kinase, receptor like 14|soluble FGFR4 variant 4

Position

10q26

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Gastric cancer, somatic;OMIM

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Apert syndrome;OMIM

Disease

Pfeiffer syndrome;OMIM

Disease

DEVELOPMENTAL;GAD

Disease

Chiari type I malformation and syringomyelia;GAD

Disease

Emphysema;FunDO

Disease

Craniosynostosis, nonspecific;OMIM

Disease

craniosynostosis;GAD

Disease

Pfeiffer syndrome;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Craniofacial-skeletal-dermatologic dysplasia;OMIM

Disease

hair thickness;GAD

Disease

Beare-Stevenson cutis gyrata syndrome;OMIM

Disease

Breast cancer;NHGRI

Disease

Antley-Bixler syndrome;OMIM

Disease

Endometriosis;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Crouzon syndrome;OMIM

Disease

breast cancer;GAD

Disease

CANCER;GAD

Disease

Craniosynostosis;FunDO

Disease

Saethre-Chotzen syndrome;OMIM

Disease

Cancer;FunDO

Disease

Jackson-Weiss syndrome;OMIM

External Links

Links to Entrez Gene

2263

Links to all GeneRIF Items

2263

Links to iHOP

2263

Sequence Information

Nucleotide Sequence

>2263 : length: 2466
atggtcagctggggtcgtttcatctgcctggtcgtggtcaccatggcaaccttgtccctg
gcccggccctccttcagtttagttgaggataccacattagagccagaagagccaccaacc
aaataccaaatctctcaaccagaagtgtacgtggctgcgccaggggagtcgctagaggtg
cgctgcctgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttgggg
cccaacaataggacagtgcttattggggagtacttgcagataaagggcgccacgcctaga
gactccggcctctatgcttgtactgccagtaggactgtagacagtgaaacttggtacttc
atggtgaatgtcacagatgccatctcatccggagatgatgaggatgacaccgatggtgcg
gaagattttgtcagtgagaacagtaacaacaagagagcaccatactggaccaacacagaa
aagatggaaaagcggctccatgctgtgcctgcggccaacactgtcaagtttcgctgccca
gccggggggaacccaatgccaaccatgcggtggctgaaaaacgggaaggagtttaagcag
gagcatcgcattggaggctacaaggtacgaaaccagcactggagcctcattatggaaagt
gtggtcccatctgacaagggaaattatacctgtgtagtggagaatgaatacgggtccatc
aatcacacgtaccacctggatgttgtggagcgatcgcctcaccggcccatcctccaagcc
ggactgccggcaaatgcctccacagtggtcggaggagacgtagagtttgtctgcaaggtt
tacagtgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaa
tacgggcccgacgggctgccctacctcaaggttctcaaggccgccggtgttaacaccacg
gacaaagagattgaggttctctatattcggaatgtaacttttgaggacgctggggaatat
acgtgcttggcgggtaattctattgggatatcctttcactctgcatggttgacagttctg
ccagcgcctggaagagaaaaggagattacagcttccccagactacctggagatagccatt
tactgcataggggtcttcttaatcgcctgtatggtggtaacagtcatcctgtgccgaatg
aagaacacgaccaagaagccagacttcagcagccagccggctgtgcacaagctgaccaaa
cgtatccccctgcggagacaggtaacagtttcggctgagtccagctcctccatgaactcc
aacaccccgctggtgaggataacaacacgcctctcttcaacggcagacacccccatgctg
gcaggggtctccgagtatgaacttccagaggacccaaaatgggagtttccaagagataag
ctgacactgggcaagcccctgggagaaggttgctttgggcaagtggtcatggcggaagca
gtgggaattgacaaagacaagcccaaggaggcggtcaccgtggccgtgaagatgttgaaa
gatgatgccacagagaaagacctttctgatctggtgtcagagatggagatgatgaagatg
attgggaaacacaagaatatcataaatcttcttggagcctgcacacaggatgggcctctc
tatgtcatagttgagtatgcctctaaaggcaacctccgagaatacctccgagcccggagg
ccacccgggatggagtactcctatgacattaaccgtgttcctgaggagcagatgaccttc
aaggacttggtgtcatgcacctaccagctggccagaggcatggagtacttggcttcccaa
aaatgtattcatcgagatttagcagccagaaatgttttggtaacagaaaacaatgtgatg
aaaatagcagactttggactcgccagagatatcaacaatatagactattacaaaaagacc
accaatgggcggcttccagtcaagtggatggctccagaagccctgtttgatagagtatac
actcatcagagtgatgtctggtccttcggggtgttaatgtgggagatcttcactttaggg
ggctcgccctacccagggattcccgtggaggaactttttaagctgctgaaggaaggacac
agaatggataagccagccaactgcaccaacgaactgtacatgatgatgagggactgttgg
catgcagtgccctcccagagaccaacgttcaagcagttggtagaagacttggatcgaatt
ctcactctcacaaccaatgaggaatacttggacctcagccaacctctcgaacagtattca
cctagttaccctgacacaagaagttcttgttcttcaggagatgattctgttttttctcca
gaccccatgccttacgaaccatgccttcctcagtatccacacataaacggcagtgttaaa
acatga

Protein Sequence

>2263 : length: 821
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV
RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYF
MVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI
NHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL
PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDK
LTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM
IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKT
TNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH
RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYS
PSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT



')