Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2260

Name

FGFR1

Synonym

BFGFR|CD331|CEK|FGFBR|FGFR-1|FLG|FLT-2|FLT2|HBGFR|KAL2|N-SAM|OGD|bFGF-R-1;fibroblast growth factor receptor 1;FGFR1;fibroblast growth factor receptor 1

Definition

FGFR1/PLAG1 fusion|FMS-like tyrosine kinase 2|basic fibroblast growth factor receptor 1|fms-related tyrosine kinase 2|heparin-binding growth factor receptor|hydroxyaryl-protein kinase|proto-oncogene c-Fgr

Position

8p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

NCAM signaling for neurite out-growth;PID Reactome;500079

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Signal transduction by L1;PID Reactome;500100

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

FGFR1c and Klotho ligand binding and activation;PID Reactome;500239

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

FGFR1c ligand binding and activation;PID Reactome;500238

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

Angiogenesis;PANTHER;P00005

Pathway

FGFR1 ligand binding and activation;PID Reactome;500236

Pathway

Glypican 1 network;PID Curated;200021

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Myeloproliferative disease;FunDO

Disease

Osteoglophonic dysplasia;OMIM

Disease

Trigonocephaly;OMIM

Disease

Cleft palate;FunDO

Disease

Craniosynostosis;FunDO

Disease

Cancer;FunDO

Disease

Kallmann syndrome 2;OMIM

Disease

Pfeiffer syndrome;OMIM

Disease

Graves' disease;FunDO

Disease

Hypogonadotropic hypogonadism;OMIM

Disease

Urogenital abnormalities;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

Jackson-Weiss syndrome;OMIM

External Links

Links to Entrez Gene

2260

Links to all GeneRIF Items

2260

Links to iHOP

2260

Sequence Information

Nucleotide Sequence

>2260 : length: 2463
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcacc
gctaggccgtccccgaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccccggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggcggaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgcaggactccgtgcccgcagactccggcctctatgct
tgcgtaaccagcagcccctcgggcagtgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcggaggatgatgatgatgatgatgactcctcttcagaggagaaagaa
acagataacaccaaaccaaaccgtatgcccgtagctccatattggacatccccagaaaag
atggaaaagaaattgcatgcagtgccggctgccaagacagtgaagttcaaatgcccttcc
agtgggaccccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgac
cacagaattggaggctacaaggtccgttatgccacctggagcatcataatggactctgtg
gtgccctctgacaagggcaactacacctgcattgtggagaatgagtacggcagcatcaac
cacacataccagctggatgtcgtggagcggtcccctcaccggcccatcctgcaagcaggg
ttgcccgccaacaaaacagtggccctgggtagcaacgtggagttcatgtgtaaggtgtac
agtgacccgcagccgcacatccagtggctaaagcacatcgaggtgaatgggagcaagatt
ggcccagacaacctgccttatgtccagatcttgaagactgctggagttaataccaccgac
aaagagatggaggtgcttcacttaagaaatgtctcctttgaggacgcaggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagaggccggcagtgatgacctcgcccctgtacctggagatcatcatctat
tgcacaggggccttcctcatctcctgcatggtggggtcggtcatcgtctacaagatgaag
agtggtaccaagaagagtgacttccacagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtgtctgctgactccagtgcatccatgaactctggggttctt
ctggttcggccatcacggctctcctccagtgggactcccatgctagcaggggtctctgag
tatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggtcttaggcaaa
cccctgggagagggctgctttgggcaggtggtgttggcagaggctatcgggctggacaag
gacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgcaacagag
aaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaagcataag
aatatcatcaacctgctgggggcctgcacgcaggatggtcccttgtatgtcatcgtggag
tatgcctccaagggcaacctgcgggagtacctgcaggcccggaggcccccagggctggaa
tactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctggtgtcc
tgcgcctaccaggtggcccgaggcatggagtatctggcctccaagaagtgcatacaccga
gacctggcagccaggaatgtcctggtgacagaggacaatgtgatgaagatagcagacttt
ggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggccgactg
cctgtgaagtggatggcacccgaggcattatttgaccggatctacacccaccagagtgat
gtgtggtctttcggggtgctcctgtgggagatcttcactctgggcggctccccatacccc
ggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcaccgcatggacaagccc
agtaactgcaccaacgagctgtacatgatgatgcgggactgctggcatgcagtgccctca
cagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttgacctcc
aaccaggagtacctggacctgtccatgcccctggaccagtactcccccagctttcccgac
acccggagctctacgtgctcctcaggggaggattccgtcttctctcatgagccgctgccc
gaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaacgccgc
tga

Protein Sequence

>2260 : length: 820
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR



')