Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2246

Name

FGF1

Synonym

AFGF|ECGF|ECGF-beta|ECGFA|ECGFB|FGF-alpha|FGFA|GLIO703|HBGF1;fibroblast growth factor 1 (acidic);FGF1;fibroblast growth factor 1 (acidic)

Definition

HBGF-1|acidic fibroblast growth factor|beta-endothelial cell growth factor|endothelial cell growth factor, alpha|endothelial cell growth factor, beta|heparin-binding growth factor 1

Position

5q31

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Adenocarcinoma;FunDO

Disease

Prostate cancer;FunDO

Disease

Intracranial aneurysm;FunDO

Disease

Alzheimer's disease;GAD

Disease

Ovarian cancer;FunDO

Disease

Cleft palate;FunDO

Disease

Advanced cancer;FunDO

Disease

Endometriosis;FunDO

Disease

Alzheimer's disease;FunDO

Disease

NEUROLOGICAL;GAD

External Links

Links to Entrez Gene

2246

Links to all GeneRIF Items

2246

Links to iHOP

2246

Sequence Information

Nucleotide Sequence

>2246 : length: 468
atggctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaag
aattggtttgttggcctcaagaagaatgggagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcttctgattaa

Protein Sequence

>2246 : length: 155
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD



')