Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

220001

Name

VWCE

Synonym

URG11|VWC1;von Willebrand factor C and EGF domains;VWCE;von Willebrand factor C and EGF domains

Definition

HBV X protein up-regulated gene 11 protein|HBxAg up-regulated gene 11 protein|von Willebrand factor C and EGF domain-containing protein

Position

11q12.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

220001

Links to all GeneRIF Items

220001

Links to iHOP

220001

Sequence Information

Nucleotide Sequence

>220001 : length: 2868
atgtgggccggactgctccttcgggccgcctgtgtcgcgctcctgctgccgggggcacca
gcccgaggctacaccgggaggaagccgcccgggcacttcgcggccgagagacgccgactg
ggcccccacgtctgcctctctgggtttgggagtggctgctgccctggctgggcgccctct
atgggtggtgggcactgcaccctgcccctctgctccttcggctgtgggagtggcatctgc
atcgctcccaatgtctgctcctgccaggatggagagcaaggggccacctgcccagaaacc
catggaccatgtggggagtacggctgtgaccttacctgcaaccatggaggctgtcaggag
gtggcccgagtgtgccccgtgggcttctcgatgacggagacagctgttggcatcaggtgt
acagacattgacgaatgtgtaacctcctcctgcgagggccactgtgtgaacacagaaggt
gggtttgtgtgcgagtgtgggccgggcatgcagctgtctgccgaccgccacagctgccaa
gacactgacgaatgcctagggactccctgtcagcagagatgtaaaaacagcattggcagc
tacaagtgttcctgtcgaactggcttccaccttcatggcaaccggcactcctgtgtagat
gtaaacgagtgtcggaggccattggagaggcgagtctgtcaccattcctgccacaacacc
gtgggcagcttcctatgcacatgccgacctggcttcaggctccgagctgaccgcgtgtcc
tgtgaagctttcccgaaagccgtgctggccccatctgccatcctgcaaccccggcaacac
ccgtccaagatgcttctgttgcttcctgaggccggccggcctgccctgtccccaggacat
agccctccttctggggctccagggcccccagccggagtcaggaccacccgcctgccatct
cccaccccacgactacccacatcctccccttctgcccctgtgtggctgctgtccaccctg
ctggccaccccagtgcctactgcctccctgctggggaacctcagacccccctcactcctt
cagggggaggtgatggggaccccttcctcacccaggggccctgagtccccccgactggca
gcagggccctctccctgctggcacctgggagccatgcatgaatcaaggagtcgctggaca
gagcctgggtgttcccagtgctggtgcgaggacgggaaggtgacctgtgaaaaggtgagg
tgtgaagctgcttgttcccacccaattccctccagagatggtgggtgctgcccatcgtgc
acaggctgttttcacagtggtgtcgtccgagctgaaggggatgtgttttcacctcccaat
gagaactgcaccgtctgtgtctgtctggctggaaacgtgtcctgcatctctcctgagtgt
ccttctggcccctgtcagacccccccacagacggattgctgtacttgtgttccagtgaga
tgctatttccacggccggtggtacgcagacggggctgtgttcagtgggggtggtgacgag
tgtaccacctgtgtttgccagaatggggaggtggagtgctccttcatgccctgccctgag
ctggcctgcccccgagaagagtggcggctgggccctgggcagtgttgcttcacctgccag
gagcccacaccctcgacaggctgctctcttgacgacaacggggttgagtttccgattgga
cagatctggtcgcctggtgacccctgtgagttatgcatctgccaggcagatggctcggtg
agctgcaagaggacagactgtgtggactcctgccctcacccgatccggatccctggacag
tgctgcccagactgttcagcaggctgcacctacacaggcagaatcttctataacaacgag
accttcccgtctgtgctggacccatgtctgagctgcatctgcctgctgggctcagtggcc
tgttcccccgtggactgccccatcacctgtacctaccctttccaccctgacggggagtgc
tgccccgtgtgccgagactgcaactacgagggaaggaaggtggcgaatggccaggtgttc
accttggatgatgaaccctgcacccggtgcacgtgccagctgggagaggtgagctgtgag
aaggttccctgccagcgggcctgtgccgaccctgccctgcttcctggggactgctgctct
tcctgtccagattccctgtctcctctggaagaaaagcaggggctctcccctcacggaaat
gtggcattcagcaaagctggtcggagcctgcatggagacactgaggcccctgtcaactgt
agctcctgtcctgggcccccgacagcatcaccctcgaggccggtgcttcatctcctccag
ctccttttaagaacgaacttgatgaaaacacagactttacctacaagcccggcaggagct
catggtccacactcactcgctttggggctgacagccactttcccaggggagcctggggcc
tcccctcgactctcaccagggccttcgacccctccaggagcccccactctacctctagct
tccccaggggctcctcagccacctcctgtgactccagagcgctcgttctcagcctctggg
gcccagatagtgtccaggtggcctcctctgcctggcaccctcctgacggaagcttcagca
ctttccatgatggaccccagcccctcgaagacccccatcaccctcctcgggcctcgcgtg
ctttctcccaccacctctagactctccacagcccttgcagccaccacccaccctggcccc
cagcagcccccagtgggggcttctcggggggaagagtccaccatgtaa

Protein Sequence

>220001 : length: 955
MWAGLLLRAACVALLLPGAPARGYTGRKPPGHFAAERRRLGPHVCLSGFGSGCCPGWAPS
MGGGHCTLPLCSFGCGSGICIAPNVCSCQDGEQGATCPETHGPCGEYGCDLTCNHGGCQE
VARVCPVGFSMTETAVGIRCTDIDECVTSSCEGHCVNTEGGFVCECGPGMQLSADRHSCQ
DTDECLGTPCQQRCKNSIGSYKCSCRTGFHLHGNRHSCVDVNECRRPLERRVCHHSCHNT
VGSFLCTCRPGFRLRADRVSCEAFPKAVLAPSAILQPRQHPSKMLLLLPEAGRPALSPGH
SPPSGAPGPPAGVRTTRLPSPTPRLPTSSPSAPVWLLSTLLATPVPTASLLGNLRPPSLL
QGEVMGTPSSPRGPESPRLAAGPSPCWHLGAMHESRSRWTEPGCSQCWCEDGKVTCEKVR
CEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPEC
PSGPCQTPPQTDCCTCVPVRCYFHGRWYADGAVFSGGGDECTTCVCQNGEVECSFMPCPE
LACPREEWRLGPGQCCFTCQEPTPSTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSV
SCKRTDCVDSCPHPIRIPGQCCPDCSAGCTYTGRIFYNNETFPSVLDPCLSCICLLGSVA
CSPVDCPITCTYPFHPDGECCPVCRDCNYEGRKVANGQVFTLDDEPCTRCTCQLGEVSCE
KVPCQRACADPALLPGDCCSSCPDSLSPLEEKQGLSPHGNVAFSKAGRSLHGDTEAPVNC
SSCPGPPTASPSRPVLHLLQLLLRTNLMKTQTLPTSPAGAHGPHSLALGLTATFPGEPGA
SPRLSPGPSTPPGAPTLPLASPGAPQPPPVTPERSFSASGAQIVSRWPPLPGTLLTEASA
LSMMDPSPSKTPITLLGPRVLSPTTSRLSTALAATTHPGPQQPPVGASRGEESTM



')