Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2146

Name

EZH2

Synonym

ENX-1|ENX1|EZH1|KMT6|KMT6A;enhancer of zeste homolog 2 (Drosophila);EZH2;enhancer of zeste homolog 2 (Drosophila)

Definition

enhancer of zeste 2|histone-lysine N-methyltransferase EZH2|lysine N-methyltransferase 6

Position

7q35-q36

Gene Type

protein-coding

External Links

Links to Entrez Gene

2146

Links to all GeneRIF Items

2146

Links to iHOP

2146

Sequence Information

Nucleotide Sequence

>2146 : length: 2241
atgggccagactgggaagaaatctgagaagggaccagtttgttggcggaagcgtgtaaaa
tcagagtacatgcgactgagacagctcaagaggttcagacgagctgatgaagtaaagagt
atgtttagttccaatcgtcagaaaattttggaaagaacggaaatcttaaaccaagaatgg
aaacagcgaaggatacagcctgtgcacatcctgacttctgtgagctcattgcgcgggact
agggagtgttcggtgaccagtgacttggattttccaacacaagtcatcccattaaagact
ctgaatgcagttgcttcagtacccataatgtattcttggtctcccctacagcagaatttt
atggtggaagatgaaactgttttacataacattccttatatgggagatgaagttttagat
caggatggtactttcattgaagaactaataaaaaattatgatgggaaagtacacggggat
agagaatgtgggtttataaatgatgaaatttttgtggagttggtgaatgcccttggtcaa
tataatgatgatgacgatgatgatgatggagacgatcctgaagaaagagaagaaaagcag
aaagatctggaggatcaccgagatgataaagaaagccgcccacctcggaaatttccttct
gataaaatttttgaagccatttcctcaatgtttccagataagggcacagcagaagaacta
aaggaaaaatataaagaactcaccgaacagcagctcccaggcgcacttcctcctgaatgt
acccccaacatagatggaccaaatgctaaatctgttcagagagagcaaagcttacactcc
tttcatacgcttttctgtaggcgatgttttaaatatgactgcttcctacatccttttcat
gcaacacccaacacttataagcggaagaacacagaaacagctctagacaacaaaccttgt
ggaccacagtgttaccagcatttggagggagcaaaggagtttgctgctgctctcaccgct
gagcggataaagaccccaccaaaacgtccaggaggccgcagaagaggacggcttcccaat
aacagtagcaggcccagcacccccaccattaatgtgctggaatcaaaggatacagacagt
gatagggaagcagggactgaaacggggggagagaacaatgataaagaagaagaagagaag
aaagatgaaacttcgagctcctctgaagcaaattctcggtgtcaaacaccaataaagatg
aagccaaatattgaacctcctgagaatgtggagtggagtggtgctgaagcctcaatgttt
agagtcctcattggcacttactatgacaatttctgtgccattgctaggttaattgggacc
aaaacatgtagacaggtgtatgagtttagagtcaaagaatctagcatcatagctccagct
cccgctgaggatgtggatactcctccaaggaaaaagaagaggaaacaccggttgtgggct
gcacactgcagaaagatacagctgaaaaaggacggctcctctaaccatgtttacaactat
caaccctgtgatcatccacggcagccttgtgacagttcgtgcccttgtgtgatagcacaa
aatttttgtgaaaagttttgtcaatgtagttcagagtgtcaaaaccgctttccgggatgc
cgctgcaaagcacagtgcaacaccaagcagtgcccgtgctacctggctgtccgagagtgt
gaccctgacctctgtcttacttgtggagccgctgaccattgggacagtaaaaatgtgtcc
tgcaagaactgcagtattcagcggggctccaaaaagcatctattgctggcaccatctgac
gtggcaggctgggggatttttatcaaagatcctgtgcagaaaaatgaattcatctcagaa
tactgtggagagattatttctcaagatgaagctgacagaagagggaaagtgtatgataaa
tacatgtgcagctttctgttcaacttgaacaatgattttgtggtggatgcaacccgcaag
ggtaacaaaattcgttttgcaaatcattcggtaaatccaaactgctatgcaaaagttatg
atggttaacggtgatcacaggataggtatttttgccaagagagccatccagactggcgaa
gagctgttttttgattacagatacagccaggctgatgccctgaagtatgtcggcatcgaa
agagaaatggaaatcccttga

Protein Sequence

>2146 : length: 746
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPA
PAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP



')