Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2118

Name

ETV4

Synonym

E1A-F|E1AF|PEA3|PEAS3;ets variant 4;ETV4;ets variant 4

Definition

E1A enhancer binding protein|ETS translocation variant 4|EWS protein/E1A enhancer binding protein chimera|adenovirus E1A enhancer-binding protein|ets variant gene 4 (E1A enhancer binding protein, E1AF)|ets variant gene 4 (E1A enhancer-binding protein, E1A

Position

17q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

LKB1 signaling events;PID Curated;200061

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Ewing's sarcoma;KEGG DISEASE;H00035

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

2118

Links to all GeneRIF Items

2118

Links to iHOP

2118

Sequence Information

Nucleotide Sequence

>2118 : length: 1455
atggagcggaggatgaaagccggatacttggaccagcaagtgccctacaccttcagcagc
aaatcgcccggaaatgggagcttgcgcgaagcgctgatcggcccgctggggaagctcatg
gacccgggctccctgccgcccctcgactctgaagatctcttccaggatctaagtcacttc
caggagacgtggctcgctgaagctcaggtaccagacagtgatgagcagtttgttcctgat
ttccattcagaaaacctagctttccacagccccaccaccaggatcaagaaggagccccag
agtccccgcacagacccggccctgtcctgcagcaggaagccgccactcccctaccaccat
ggcgagcagtgcctttactccagtgcctatgacccccccagacaaatcgccatcaagtcc
cctgcccctggtgcccttggacagtcgcccctacagccctttccccgggcagagcaacgg
aatttcctgagatcctctggcacctcccagccccaccctggccatgggtacctcggggaa
catagctccgtcttccagcagcccctggacatttgccactccttcacatctcagggaggg
ggccgggaacccctcccagccccctaccaacaccagctgtcggagccctgcccaccctat
ccccagcagagctttaagcaagaataccatgatcccctgtatgaacaggcgggccagcca
gccgtggaccagggtggggtcaatgggcacaggtacccaggggcgggggtggtgatcaaa
caggaacagacggacttcgcctacgactcagatgtcaccgggtgcgcatcaatgtacctc
cacacagagggcttctctgggccctctccaggtgacggggccatgggctatggctatgag
aaacctctgcgaccattcccagatgatgtctgcgttgtccctgagaaatttgaaggagac
atcaagcaggaaggggtcggtgcatttcgagaggggccgccctaccagcgccggggtgcc
ctgcagctgtggcaatttctggtggccttgctggatgacccaacaaatgcccatttcatt
gcctggacgggccggggaatggagttcaagctcattgagcctgaggaggtcgccaggctc
tggggcatccagaagaaccggccagccatgaattacgacaagctgagccgctcgctccga
tactattatgagaaaggcatcatgcagaaggtggctggtgagcgttacgtgtacaagttt
gtgtgtgagcccgaggccctcttctctttggccttcccggacaatcagcgtccagctctc
aaggctgagtttgaccggcctgtcagtgaggaggacacagtccctttgtcccacttggat
gagagccccgcctacctcccagagctggctggccccgcccagccatttggccccaagggt
ggctactcttactag

Protein Sequence

>2118 : length: 484
MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHF
QETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHH
GEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGE
HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQP
AVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYE
KPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFI
AWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF
VCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKG
GYSY



')