Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2077

Name

ERF

Synonym

PE-2|PE2;Ets2 repressor factor;ERF;Ets2 repressor factor

Definition

ETS domain-containing transcription factor ERF

Position

19q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

PDGF signaling pathway;PANTHER;P00047

Disease

Leukemia;FunDO

Disease

Down syndrome;FunDO

External Links

Links to Entrez Gene

2077

Links to all GeneRIF Items

2077

Links to iHOP

2077

Sequence Information

Nucleotide Sequence

>2077 : length: 1647
atgaagaccccggcggacacagggtttgccttcccggattgggcctacaagccagagtcg
tcccctggctcaaggcagatccagctgtggcactttatcctggagctgctgcggaaggag
gagtaccagggcgtcattgcctggcagggggactacggggaattcgtcatcaaagaccct
gatgaggtggcccggctgtggggcgttcgcaagtgcaagccccagatgaattacgacaag
ctgagccgggccctgcgctattactataacaagcgcattctgcacaagaccaaggggaaa
cggttcacctacaagttcaatttcaacaaactggtgctggtcaattacccattcattgat
gtggggttggctgggggtgcagtgccccagagtgccccgccagtgccgtcgggtggtagc
cacttccgcttccctccctcaacgccctccgaggtgctgtcccccaccgaggacccccgc
tcaccaccagcctgctcttcatcttcatcttccctcttctcggctgtggtggcccgccgc
ctgggccgaggctcagtcagtgactgtagtgatggcacgtcagagctggaggaaccgctg
ggagaggatccccgcgcccgaccacccggccctccggatctgggtgccttccgagggccc
ccgctggcccgcctgccccatgaccctggtgtcttccgagtctatccccggcctcggggt
ggccctgaacccctcagccccttccctgtgtcgcctctggccggtcctggatccctgctg
ccccctcagctctccccggctctgcccatgacgcccacccacctggcctacactccctcg
cccacgctgagcccgatgtaccccagtggtggcggggggcccagcggctcagggggaggc
tcccacttctccttcagccctgaggacatgaaacggtacctgcaggcccacacccaaagc
gtctacaactaccacctcagcccccgcgccttcctgcactaccctgggctggtggtgccc
cagccccagcgccctgacaagtgcccgctgccgcccatggcacccgagaccccaccggtc
ccctcctcggcctcgtcatcctcttcttcttcttcctccccattcaagtttaagctccag
ccgcccccactcggacgccggcagcgggcagctggggagaaggccgtagccggtgctgac
aagagcggtggcagtgcaggcgggctggctgagggggcaggggcgctagccccaccgccc
ccgccaccacagatcaaggtggagcccatctcggaaggcgagtcggaggaggtagaggtg
actgacatcagtgatgaggatgaggaagacggggaggtgttcaagacgccccgtgcccca
cctgcaccccctaagcctgagcccggcgaggcacccggggcatcccagtgcatgcccctc
aagctacgctttaagcggcgctggagtgaagactgtcgcctcgaagggggtgggggcccc
gctgggggctttgaggatgagggtgaggacaagaaggtgcgtggggaggggcctggggag
gctggggggcccctcaccccaaggcgggtgagctctgacctccagcatgccacggcccag
ctctccctggagcaccgagactcctga

Protein Sequence

>2077 : length: 548
MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDP
DEVARLWGVRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVLVNYPFID
VGLAGGAVPQSAPPVPSGGSHFRFPPSTPSEVLSPTEDPRSPPACSSSSSSLFSAVVARR
LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRG
GPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSGGGGPSGSGGG
SHFSFSPEDMKRYLQAHTQSVYNYHLSPRAFLHYPGLVVPQPQRPDKCPLPPMAPETPPV
PSSASSSSSSSSSPFKFKLQPPPLGRRQRAAGEKAVAGADKSGGSAGGLAEGAGALAPPP
PPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKTPRAPPAPPKPEPGEAPGASQCMPL
KLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTPRRVSSDLQHATAQ
LSLEHRDS



')