Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

207

Name

AKT1

Synonym

AKT|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA;v-akt murine thymoma viral oncogene homolog 1;AKT1;v-akt murine thymoma viral oncogene homolog 1

Definition

PKB alpha|RAC-PK-alpha|RAC-alpha serine/threonine-protein kinase|protein kinase B alpha|proto-oncogene c-Akt|rac protein kinase alpha

Position

14q32.32|14q32.32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

role of erbb2 in signal transduction and oncology;PID BioCarta;100147

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

mtor signaling pathway;PID BioCarta;100101

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Regulation of beta-cell development;Reactome;REACT:13698

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

eNOS activation;PID Reactome;500849

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Endothelins;PID Curated;200004

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Aurora A signaling;PID Curated;200166

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Huntington disease;PANTHER;P00029

Pathway

nfat and hypertrophy of the heart ;PID BioCarta;100098

Pathway

b cell survival pathway;PID BioCarta;100228

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

Hemostasis;Reactome;REACT:604

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

trka receptor signaling pathway;PID BioCarta;100011

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Nephrin/Neph1 signaling in the kidney podocyte;PID Curated;200132

Pathway

Negative regulation of the PI3K/AKT network;PID Reactome;500642

Pathway

AKT-mediated inactivation of FOXO1A;PID Reactome;500523

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

human cytomegalovirus and map kinase pathways;PID BioCarta;100149

Pathway

p53 pathway;PID Curated;200175

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

Activation of BAD and translocation to mitochondria;PID Reactome;500261

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

CXCR3-mediated signaling events;PID Curated;200150

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

p53 pathway;PANTHER;P00059

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

Angiogenesis;PANTHER;P00005

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

IGF1 pathway;PID Curated;200084

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

transcription factor creb and its extracellular signals;PID BioCarta;100198

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

AKT phosphorylates targets in the nucleus;PID Reactome;500641

Pathway

role of nicotinic acetylcholine receptors in the regulation of apoptosis;PID BioCarta;100255

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

CTLA4 inhibitory signaling;PID Reactome;500487

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

p53 pathway by glucose deprivation;PANTHER;P04397

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

PI3K/AKT signalling;PID Reactome;500639

Pathway

telomeres telomerase cellular aging and immortality;PID BioCarta;100021

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

trefoil factors initiate mucosal healing;PID BioCarta;100018

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

corticosteroids and cardioprotection;PID BioCarta;100156

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

FGF signaling pathway;PID Curated;200189

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

FAS signaling pathway;PANTHER;P00020

Pathway

AKT phosphorylates targets in the cytosol;PID Reactome;500640

Pathway

Insulin Pathway;PID Curated;200012

Pathway

CD28 dependent PI3K/Akt signaling;PID Reactome;500485

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

actions of nitric oxide in the heart;PID BioCarta;100094

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

FAS (CD95) signaling pathway;PID Curated;200067

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

Metabolism of nitric oxide;Reactome;REACT:12508

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Insulin-mediated glucose transport;PID Curated;200168

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

il 4 signaling pathway;PID BioCarta;100127

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

VEGFR3 signaling in lymphatic endothelium;PID Curated;200188

Pathway

ion channels and their functional role in vascular endothelium;PID BioCarta;100055

Pathway

akt signaling pathway;PID BioCarta;100245

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

T cell activation;PANTHER;P00053

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Carbohydrate digestion and absorption;KEGG PATHWAY;hsa04973

Pathway

role of erk5 in neuronal survival pathway;PID BioCarta;100171

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Hypoxia response via HIF activation;PANTHER;P00030

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

apoptotic signaling in response to dna damage;PID BioCarta;100204

Pathway

control of skeletal myogenesis by hdac and calcium/calmodulin-dependent kinase (camk);PID BioCarta;100148

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

the igf-1 receptor and longevity;PID BioCarta;100115

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

FoxO family signaling;PID Curated;200091

Pathway

FOXA2 and FOXA3 transcription factor networks;PID Curated;200073

Pathway

Ras Pathway;PANTHER;P04393

Pathway

regulation of eif-4e and p70s6 kinase;PID BioCarta;100178

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Ovarian cancer, somatic;OMIM

Disease

Hyperglycemia;FunDO

Disease

Cancer;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Huntington disease;FunDO

Disease

Colorectal cancer, somatic;OMIM

Disease

Vitiligo;FunDO

Disease

Polycystic ovary syndrome;FunDO

Disease

Systemic infection;FunDO

Disease

Schizophrenia;FunDO

Disease

PSYCH;GAD

Disease

Diabetes mellitus;FunDO

Disease

CHEMDEPENDENCY;GAD

Disease

Psychotic disorder;FunDO

Disease

Tropical spastic paraparesis;FunDO

Disease

Adenovirus infection;FunDO

Disease

Schizophrenia, susceptibility to;OMIM

Disease

Breast cancer, somatic;OMIM

Disease

Hypertension;FunDO

Disease

methamphetamine abuse;GAD

Disease

schizophrenia;GAD

Disease

Obesity;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

207

Links to all GeneRIF Items

207

Links to iHOP

207

Sequence Information

Nucleotide Sequence

>207 : length: 1443
atgagcgacgtggctattgtgaaggagggttggctgcacaaacgaggggagtacatcaag
acctggcggccacgctacttcctcctcaagaatgatggcaccttcattggctacaaggag
cggccgcaggatgtggaccaacgtgaggctcccctcaacaacttctctgtggcgcagtgc
cagctgatgaagacggagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcatcgaacgcaccttccatgtggagactcctgaggagcgggaggagtggaca
accgccatccagactgtggctgacggcctcaagaagcaggaggaggaggagatggacttc
cggtcgggctcacccagtgacaactcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgcgtgaccatgaacgagtttgagtacctgaagctgctgggcaagggcact
ttcggcaaggtgatcctggtgaaggagaaggccacaggccgctactacgccatgaagatc
ctcaagaaggaagtcatcgtggccaaggacgaggtggcccacacactcaccgagaaccgc
gtcctgcagaactccaggcaccccttcctcacagccctgaagtactctttccagacccac
gaccgcctctgctttgtcatggagtacgccaacgggggcgagctgttcttccacctgtcc
cgggagcgtgtgttctccgaggaccgggcccgcttctatggcgctgagattgtgtcagcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggacggtgccaccatgaagaccttttgcggcacacctgagtacctggcccccgaggtg
ctggaggacaatgactacggccgtgcagtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggtcgcctgcccttctacaaccaggaccatgagaagctttttgagctc
atcctcatggaggagatccgcttcccgcgcacgcttggtcccgaggccaagtccttgctt
tcagggctgctcaagaaggaccccaagcagaggcttggcgggggctccgaggacgccaag
gagatcatgcagcatcgcttctttgccggtatcgtgtggcagcacgtgtacgagaagaag
ctcagcccacccttcaagccccaggtcacgtcggagactgacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacaccacctgaccaagatgacagcatggagtgt
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

Protein Sequence

>207 : length: 480
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA



')