Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2056

Name

EPO

Synonym

EP|MVCD2;erythropoietin;EPO;erythropoietin

Definition

epoetin

Position

7q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

erythropoietin mediated neuroprotection through nf-kb;PID BioCarta;100176

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

Pathway

epo signaling pathway;PID BioCarta;100175

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Disease

Drug abuse;FunDO

Disease

Ischemia;FunDO

Disease

Anemia;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Chronic simple glaucoma;FunDO

Disease

Premature birth;FunDO

Disease

HEMATOLOGICAL;GAD

Disease

Brain ischemia;FunDO

Disease

Microvascular complications of diabetes 2;OMIM

Disease

Congenital abnormality;FunDO

Disease

Liver disease;FunDO

Disease

Cancer;FunDO

Disease

Deafness;FunDO

Disease

Kidney failure;FunDO

Disease

Polycythemia;FunDO

Disease

Other erythrocyte phenotypes;NHGRI

Disease

Endometriosis;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

other erythrocyte phenotypes;GAD

External Links

Links to Entrez Gene

2056

Links to all GeneRIF Items

2056

Links to iHOP

2056

Sequence Information

Nucleotide Sequence

>2056 : length: 582
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtccctgctgtcgctccct
ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatatcacgacgggctgtgctgaacactgc
agcttgaatgagaatatcactgtcccagacaccaaagttaatttctatgcctggaagagg
atggaggtcgggcagcaggccgtagaagtctggcagggcctggccctgctgtcggaagct
gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg
catgtggataaagccgtcagtggccttcgcagcctcaccactctgcttcgggctctggga
gcccagaaggaagccatctcccctccagatgcggcctcagctgctccactccgaacaatc
actgctgacactttccgcaaactcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacaggggaggcctgcaggacaggggacagatga

Protein Sequence

>2056 : length: 193
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR



')