Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

2001

Name

ELF5

Synonym

ESE2;E74-like factor 5 (ets domain transcription factor);ELF5;E74-like factor 5 (ets domain transcription factor)

Definition

ETS-related transcription factor Elf-5|epithelium-restricted ESE-1-related Ets factor|epithelium-specific Ets transcription factor 2

Position

11p13-p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

PDGF signaling pathway;PANTHER;P00047

External Links

Links to Entrez Gene

2001

Links to all GeneRIF Items

2001

Links to iHOP

2001

Sequence Information

Nucleotide Sequence

>2001 : length: 768
atgttggactcggtgacacacagcaccttcctgcctaatgcatccttctgcgatcccctg
atgtcgtggactgatctgttcagcaatgaagagtactaccctgcctttgagcatcagaca
gcctgtgactcatactggacatcagtccaccctgaatactggactaagcgccatgtgtgg
gagtggctccagttctgctgcgaccagtacaagttggacaccaattgcatctccttctgc
aacttcaacatcagtggcctgcagctgtgcagcatgacacaggaggagttcgtcgaggca
gctggcctctgcggcgagtacctgtacttcatcctccagaacatccgcacacaaggttac
tccttttttaatgacgctgaagaaagcaaggccaccatcaaagactatgctgattccaac
tgcttgaaaacaagtggcatcaaaagtcaagactgtcacagtcatagtagaacaagcctc
caaagttctcatctatgggaatttgtacgagacctgcttctatctcctgaagaaaactgt
ggcattctggaatgggaagatagggaacaaggaatttttcgggtggttaaatcggaagcc
ctggcaaagatgtggggacaaaggaagaaaaatgacagaatgacatatgaaaagttgagc
agagccctgagatactactataaaacaggaattttggagcgggttgaccgaaggttagtg
tacaaatttggaaaaaatgcacacgggtggcaggaagacaagctatga

Protein Sequence

>2001 : length: 255
MLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVHPEYWTKRHVW
EWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGY
SFFNDAEESKATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVRDLLLSPEENC
GILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLV
YKFGKNAHGWQEDKL



')