Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1958

Name

EGR1

Synonym

AT225|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225;early growth response 1;EGR1;early growth response 1

Definition

EGR-1|early growth response protein 1|nerve growth factor-induced protein A|transcription factor ETR103|transcription factor Zif268|zinc finger protein 225|zinc finger protein Krox-24

Position

5q31.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Prion diseases;KEGG PATHWAY;hsa05020

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

phosphorylation of mek1 by cdk5/p35 down regulates the map kinase pathway;PID BioCarta;100210

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Disease

Emphysema;FunDO

Disease

Prostate cancer;FunDO

Disease

Infectious lung disease;FunDO

Disease

Asthma;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Congenital abnormality;FunDO

Disease

Cancer;FunDO

Disease

Dental plaque;FunDO

Disease

Epilepsy;FunDO

External Links

Links to Entrez Gene

1958

Links to all GeneRIF Items

1958

Links to iHOP

1958

Sequence Information

Nucleotide Sequence

>1958 : length: 1632
atggccgcggccaaggccgagatgcagctgatgtccccgctgcagatctctgacccgttc
ggatcctttcctcactcgcccaccatggacaactaccctaagctggaggagatgatgctg
ctgagcaacggggctccccagttcctcggcgccgccggggccccagagggcagcggcagc
aacagcagcagcagcagcagcgggggcggtggaggcggcgggggcggcagcaacagcagc
agcagcagcagcaccttcaaccctcaggcggacacgggcgagcagccctacgagcacctg
accgcagagtcttttcctgacatctctctgaacaacgagaaggtgctggtggagaccagt
taccccagccaaaccactcgactgccccccatcacctatactggccgcttttccctggag
cctgcacccaacagtggcaacaccttgtggcccgagcccctcttcagcttggtcagtggc
ctagtgagcatgaccaacccaccggcctcctcgtcctcagcaccatctccagcggcctcc
tccgcctccgcctcccagagcccacccctgagctgcgcagtgccatccaacgacagcagt
cccatttactcagcggcacccaccttccccacgccgaacactgacattttccctgagcca
caaagccaggccttcccgggctcggcagggacagcgctccagtacccgcctcctgcctac
cctgccgccaagggtggcttccaggttcccatgatccccgactacctgtttccacagcag
cagggggatctgggcctgggcaccccagaccagaagcccttccagggcctggagagccgc
acccagcagccttcgctaacccctctgtctactattaaggcctttgccactcagtcgggc
tcccaggacctgaaggccctcaataccagctaccagtcccagctcatcaaacccagccgc
atgcgcaagtaccccaaccggcccagcaagacgcccccccacgaacgcccttacgcttgc
ccagtggagtcctgtgatcgccgcttctcccgctccgacgagctcacccgccacatccgc
atccacacaggccagaagcccttccagtgccgcatctgcatgcgcaacttcagccgcagc
gaccacctcaccacccacatccgcacccacacaggcgaaaagcccttcgcctgcgacatc
tgtggaagaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacttgcgg
cagaaggacaagaaagcagacaaaagtgttgtggcctcttcggccacctcctctctctct
tcctacccgtccccggttgctacctcttacccgtccccggttactacctcttatccatcc
ccggccaccacctcatacccatcccctgtgcccacctccttctcctctcccggctcctcg
acctacccatcccctgtgcacagtggcttcccctccccgtcggtggccaccacgtactcc
tctgttccccctgctttcccggcccaggtcagcagcttcccttcctcagctgtcaccaac
tccttcagcgcctccacagggctttcggacatgacagcaaccttttctcccaggacaatt
gaaatttgctaa

Protein Sequence

>1958 : length: 543
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
EIC



')