Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1950

Name

EGF

Synonym

HOMG4|URG;epidermal growth factor;EGF;epidermal growth factor

Definition

beta-urogastrone|pro-epidermal growth factor

Position

4q25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

EGFR downregulation;PID Reactome;500515

Pathway

sprouty regulation of tyrosine kinase signals;PID BioCarta;100029

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

EGFR-dependent Endothelin signaling events;PID Curated;200095

Pathway

egf signaling pathway;PID BioCarta;100181

Pathway

cbl mediated ligand-induced downregulation of egf receptors pathway;PID BioCarta;100216

Pathway

EGF receptor (ErbB1) signaling pathway;PID Curated;200085

Pathway

Signaling by EGFR;PID Reactome;500510

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

map kinase inactivation of smrt corepressor;PID BioCarta;100032

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

ErbB receptor signaling network;PID Curated;200136

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

Arf6 signaling events;PID Curated;200060

Pathway

mcalpain and friends in cell motility;PID BioCarta;100111

Pathway

Internalization of ErbB1;PID Curated;200146

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221

Disease

Hair morphology;NHGRI

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Cytomegalovirus infection;FunDO

Disease

Cancer;FunDO

Disease

arrhythmia, cardiac;GAD

Disease

DEVELOPMENTAL;GAD

Disease

Keratosis;FunDO

Disease

IMMUNE;GAD

Disease

Infection;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

brain cancer;GAD

Disease

prostate cancer;GAD

Disease

METABOLIC;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

periodontitis;GAD

Disease

Schizophrenia;FunDO

Disease

Cirrhosis;FunDO

Disease

malignant melanoma;GAD

Disease

Drug abuse;FunDO

Disease

PSYCH;GAD

Disease

Diabetes mellitus;FunDO

Disease

hair morphology;GAD

Disease

CARDIOVASCULAR;GAD

Disease

CANCER;GAD

Disease

Kidney failure;FunDO

Disease

Hypomagnesemia 4, renal;OMIM

Disease

Autistic disorder;FunDO

Disease

Endometriosis;FunDO

Disease

Birth Weight;GAD

Disease

Necrotizing enterocolitis;FunDO

Disease

Growth retardation;FunDO

Disease

Cancers;KEGG DISEASE

Disease

IGA glomerulonephritis;FunDO

Disease

heart rate;GAD

Disease

schizophrenia;GAD

Disease

stomach cancer;GAD

External Links

Links to Entrez Gene

1950

Links to all GeneRIF Items

1950

Links to iHOP

1950

Sequence Information

Nucleotide Sequence

>1950 : length: 3501
atgctgctcactcttatcattctgttgccagtagtttcaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactctcgcaggaaatgggaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaaatagtatctttaggattgac
acagaaggaaccaattatgagcaattggtggtggatgctggtgtctcagtgatcatggat
tttcattataatgagaaaagaatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacattcttttaagtgctttaaaatatcct
gcaaatgtagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctgga
agcctttatagagcagatctcgatggtgtgggagtgaaggctctgttggagacatcagag
aaaataacagctgtgtcattggatgtgcttgataagcggctgttttggattcagtacaac
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccacatt
agtaaacatccaacacagcataatttgtttgcaatgtccctttttggtgaccgtatcttc
tattcaacatggaaaatgaagacaatttggatagccaacaaacacactggaaaggacatg
gttagaattaacctccattcatcatttgtaccacttggtgaactgaaagtagtgcatcca
cttgcacaacccaaggcagaagatgacacttgggagcctgagcagaaactttgcaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacctccagtcacacttgtgcatg
tgtgcagagggatacgccctaagtcgagaccggaagtactgtgaagatgttaatgaatgt
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acgtgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccacgcaatgtgtctgaatgcagccatgactgtgttctgacatcagaaggtccctta
tgtttctgtcctgaaggctcagtgcttgagagagatgggaaaacatgtagcggttgttcc
tcacccgataatggtggatgtagccagctctgcgttcctcttagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggatgaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaatggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgtagattctattggacagacagagggaaatctctgattgga
aggagtgatttaaatgggaaacgttccaaaataatcactaaggagaacatctctcaacca
cgaggaattgctgttcatccaatggccaagagattattctggactgatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgtctggttatagccagctctgat
ctaatctggcccagtggaataacgattgacttcttaactgacaagttgtactggtgcgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccgaagacttacc
cagaatgatgtaggtcacccatttgctgtagcagtgtttgaggattatgtgtggttctca
gattgggctatgccatcagtaatgagagtaaacaagaggactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcatcactggttgtggttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaacggaggctgtgaacatatttgcaaaaagaggctt
ggaactgcttggtgttcgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatctaaagaaccaagta
acaccattggacatcttgtccaagactagagtgtcagaagataacattacagaatctcaa
cacatgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcctgtgggatgc
agcatgtatgctcggtgtatttcagagggagaggatgccacatgtcagtgtttgaaagga
tttgctggggatggaaaactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaaggtggttatgtctgccggtgctca
gaaggctaccaaggagatgggattcactgtcttgactctactccaccccctcacctcagg
gaagatgaccaccactattccgtaagaaatagtgactctgaatgtcccctgtcccacgat
gggtactgcctccatgatggtgtgtgcatgtatattgaagcattggacaagtatgcatgc
aactgtgttgttggctacatcggggagcgatgtcagtaccgagacctgaagtggtgggaa
ctgcgccacgctggccacgggcagcagcagaaggtcatcgtggtggctgtctgcgtggtg
gtgcttgtcatgctgctcctcctgagcctgtggggggcccactactacaggactcagaag
ctgctatcgaaaaacccaaagaatccttatgaggagtcgagcagagatgtgaggagtcgc
aggcctgctgacactgaggatgggatgtcctcttgccctcaaccttggtttgtggttata
aaagaacaccaagacctcaagaatgggggtcaaccagtggctggtgaggatggccaggca
gcagatgggtcaatgcaaccaacttcatggaggcaggagccccagttatgtggaatgggc
acagagcaaggctgctggattccagtatccagtgataagggctcctgtccccaggtaatg
gagcgaagctttcatatgccctcctatgggacacagacccttgaagggggtgtcgagaag
ccccattctctcctatcagctaacccattatggcaacaaagggccctggacccaccacac
caaatggagctgactcagtga

Protein Sequence

>1950 : length: 1166
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYAC
NCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLSLWGAHYYRTQK
LLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQA
ADGSMQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEK
PHSLLSANPLWQQRALDPPHQMELTQ



')