Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1909

Name

EDNRA

Synonym

ET-A|ETA|ETA-R|ETAR|ETRA|hET-AR;endothelin receptor type A;EDNRA;endothelin receptor type A

Definition

G protein-coupled receptor|endothelin receptor subtype A|endothelin-1 receptor|endothelin-1-specific receptor

Position

4q31.22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Endothelins;PID Curated;200004

Pathway

EGFR-dependent Endothelin signaling events;PID Curated;200095

Pathway

Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

Signaling by GPCR;Reactome;REACT:14797

Disease

Primary tumor;FunDO

Disease

NEUROLOGICAL;GAD

Disease

Kaposi sarcoma;FunDO

Disease

migraine;GAD

Disease

Breast cancer;FunDO

Disease

Glaucoma;FunDO

Disease

hypertension;GAD

Disease

Pancreatitis;FunDO

Disease

VISION;GAD

Disease

Heart Failure;GAD

Disease

Pre-Eclampsia;FunDO

Disease

Capillaries disease;FunDO

Disease

Diabetes mellitus;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

atherosclerosis, generalized;GAD

Disease

Renal Cell cancer;FunDO

Disease

Heart failure;FunDO

Disease

glaucoma, normal tension;GAD

Disease

Migraine, resistance to;OMIM

Disease

Prostate cancer;FunDO

Disease

Ovarian cancer;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

1909

Links to all GeneRIF Items

1909

Links to iHOP

1909

Sequence Information

Nucleotide Sequence

>1909 : length: 957
atggaaaccctttgcctcagggcatccttttggctggcactggttggatgtgtaatcagt
gataatcctgagagatacagcacaaatctaagcaatcatgtggatgatttcaccactttt
cgtggcacagagctcagcttcctggttaccactcatcaacccactaatttggtcctaccc
agcaatggctcaatgcacaactattgcccacagcagactaaaattacttcagctttcaaa
tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact
ctgctcaggatcatttaccagaacaaatgtatgaggaatggccccaacgcgctgatagcc
agtcttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag
ttctaccaagatgtaaaggactggtggctcttcgggttctatttctgtatgcccttggtg
tgcactgcgatcttctacaccctcatgacttgtgagatgttgaacagaaggaatggcagc
ttgagaattgccctcagtgaacatcttaagcagcgtcgagaagtggcaaaaacagttttc
tgcttggttgtaatttttgctctttgctggttccctcttcatttaagccgtatattgaag
aaaactgtgtataacgagatggacaagaaccgatgtgaattacttagtttcttactgctc
atggattacatcggtattaacttggcaaccatgaattcatgtataaaccccatagctctg
tattttgtgagcaagaaatttaaaaattgtttccagtcatgcctctgctgctgctgttac
cagtccaaaagtctgatgacctcggtccccatgaacggaacaagcatccagtggaagaac
cacgatcaaaacaaccacaacacagaccggagcagccataaggacagcatgaactga

Protein Sequence

>1909 : length: 318
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGS
LRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLL
MDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKN
HDQNNHNTDRSSHKDSMN



')