Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1906

Name

EDN1

Synonym

ET1|HDLCQ7|PPET1;endothelin 1;EDN1;endothelin 1

Definition

endothelin-1|preproendothelin-1

Position

6p24.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

nfat and hypertrophy of the heart ;PID BioCarta;100098

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Endothelins;PID Curated;200004

Pathway

EGFR-dependent Endothelin signaling events;PID Curated;200095

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221

Disease

Polycythemia;FunDO

Disease

Ischemia;FunDO

Disease

Primary tumor;FunDO

Disease

Osteitis deformans;FunDO

Disease

Bladder cancer;FunDO

Disease

Bone metastases;FunDO

Disease

Atopic rhinitis;FunDO

Disease

Melanoma;FunDO

Disease

diabetes, type 2;GAD

Disease

Polyarthritis;FunDO

Disease

Respiratory distress syndrome;FunDO

Disease

left ventricular hypertrophy;GAD

Disease

Breast cancer;FunDO

Disease

cirrhosis;GAD

Disease

vitiligo;GAD

Disease

Subarachnoid hemorrhage;FunDO

Disease

Embryoma;FunDO

Disease

hypertension;GAD

Disease

Amnionitis;FunDO

Disease

Gingival overgrowth;FunDO

Disease

VISION;GAD

Disease

IMMUNE;GAD

Disease

Systemic scleroderma;FunDO

Disease

Endemic goiter;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Pulmonary fibrosis;FunDO

Disease

Vitiligo;FunDO

Disease

Systemic infection;FunDO

Disease

METABOLIC;GAD

Disease

Stroke;FunDO

Disease

Asthma;GAD

Disease

Kidney disease;FunDO

Disease

Colon cancer;FunDO

Disease

Prostatic hypertrophy, Benign;FunDO

Disease

Heart Failure;GAD

Disease

Capillaries disease;FunDO

Disease

Gastritis;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Hypertension;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Hyperinsulinism;FunDO

Disease

CANCER;GAD

Disease

blood pressure, arterial;GAD

Disease

Basal cell carcinoma;FunDO

Disease

glaucoma;GAD

Disease

Brain tumor;FunDO

Disease

lymphoma, cutaneous T-cell;GAD

Disease

Graves' disease;FunDO

Disease

kidney dysfunction;GAD

Disease

plasma endothelin-1 levels;GAD

Disease

glaucoma, primary open-angle;GAD

Disease

Growth retardation;FunDO

Disease

Heart failure;FunDO

Disease

Squamous cell cancer;FunDO

Disease

IGA glomerulonephritis;FunDO

Disease

Total IgE. Eosinophilia. DRS;GAD

Disease

Prostate cancer;FunDO

Disease

Pancreatitis;FunDO

Disease

Ovarian cancer;FunDO

Disease

Obesity;FunDO

Disease

High density lipoprotein cholesterol level QTL 7;OMIM

Disease

atherosclerosis, coronary cholesterol, HDL;GAD

Disease

Filariasis;FunDO

Disease

arrhythmia, cardiac;GAD

Disease

Rabies;FunDO

Disease

Asthma;FunDO

Disease

RENAL;GAD

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

1906

Links to all GeneRIF Items

1906

Links to iHOP

1906

Sequence Information

Nucleotide Sequence

>1906 : length: 636
atggattatttgctcatgattttctctctgctgtttgtggcttgccaaggagctccagaa
acagtcttaggcgctgagctcagcgcggtgggtgagaacggcggggagaaacccactccc
agtccaccctggcggctccgccggtccaagcgctgctcctgctcgtccctgatggataaa
gagtgtgtctacttctgccacctggacatcatttgggtcaacactcccgagcacgttgtt
ccgtatggacttggaagccctaggtccaagagagccttggagaatttacttcccacaaag
gcaacagaccgtgaaaatagatgccaatgtgctagccaaaaagacaagaagtgctggaat
ttttgccaagcaggaaaagaactcagggctgaagacattatggagaaagactggaataat
cataagaaaggaaaagactgttccaagcttgggaaaaagtgtatttatcagcagttagtg
agaggaagaaaaatcagaagaagttcagaggaacacctaagacaaaccaggtcggagacc
atgagaaacagcgtcaaatcatcttttcatgatcccaagctgaaaggcaagccctccaga
gagcgttatgtgacccacaaccgagcacattggtga

Protein Sequence

>1906 : length: 211
MDYLLMIFSLLFVACQGAPETVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDK
ECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWN
FCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSET
MRNSVKSSFHDPKLKGKPSRERYVTHNRAHW



')